SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012675 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012675
Domain Number 1 Region: 352-573
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-51
Family DBL homology domain (DH-domain) 0.0000996
Further Details:      
 
Domain Number 2 Region: 578-709
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-25
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 107-195
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-17
Family Ras-binding domain, RBD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012675   Gene: ENSXMAG00000012638   Transcript: ENSXMAT00000012691
Sequence length 1094
Comment pep:novel scaffold:Xipmac4.4.2:JH556691.1:2476420:2523224:1 gene:ENSXMAG00000012638 transcript:ENSXMAT00000012691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCHHPDCQDLNSKSPLHLCDSCDSRCHPESADNMHFDRHPRFDLQPQASILARNVSTRS
CPPRTSPPSDLEEEDEGSNDRGERKTVGMKLGKKKPRRRHTDDPSKECFSLKFDLNVDIN
TEIVPAMKKKTLREVLGPVFERNGIELSRVDLFLDQSNTPLSLHFEAYRLGGHYLKVKAR
PGDEVKVAQSVKDFRSHSLPIMKPPDGQSPYILTPREKVAHESLGRRESIDLLGQARRRK
NMTEFLGETNIPTQDALGQLGGSLPAVGAGPDSWKNRAASRFSGLFGSNAGAGPFGKELD
RLEQLQSKLHSYSLFGLPKVPRQLSFHHDSWEGEEEANLVMEDSWKTLLDDPEVLTKRQF
HQQEAIWELLNTEATYIKKLRVITDLFQCGLLNLQESGLLTDVEPTKLFSNIQEIVRLHI
SLWNHVMLPVLKKAREARALLDPTHLHDGFRTFGSRFQPYIHYCMEEESCMEYMRTLLRD
NEPFRTYVTWAETHKQCNRLKLADMLAKPHQRLTKYPLLLKSILKKTDEPSARDIVNSML
VTVESFINSVDSQMRQRQEQQKLATISARIDSYEAVEGSSEEVEKILKEYNRFDLMSPMR
ETSPEETRQLHLEGALRMKEGKDSRMEVYCFLFTDLLLITKPVKRVEKVKIIRQPLLIHN
VVCKELKDPGSFILIYLNEFKSAVAAYTFQANSASQGRSWIDAICNVQNQLQRLRSQEAL
RQQDIQKKCTAEDEEEEEDESSNSATSSPILRHKEEPNSSQSDGSTETLSVMDVDEPTEH
QQSPASSTNFEECSSRDSEPDLVLLSDRSELQQSTYRAHPIVYIGQIQEENEELDPQRRS
LSMDSAYGTLSPESFQRELQPQPIQSEGEEVEVVQDQEVEFGKNGKVEEQKEEEEEEEEE
EEEEENASVGSQLSVVQSTKPRRRPPVQSKVQCIQRLTSLTFSRSEDNLLQRVHGEENPV
SHTHSFNSESQELDCTDVDPSSLAHSKSLSELRRNGFNLSEDCLSSSLPADKLQASLSRA
KVMLNRKTQEEVDGETAPSSRADRKCETTTADTNSPKNKKRKSPAQQHKKLTLAQLYKIR
TTLVLNSTLTASEV
Download sequence
Identical sequences M4ADY1
ENSXMAP00000012675 ENSXMAP00000012675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]