SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012950 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012950
Domain Number 1 Region: 98-267
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.89e-50
Family CRAL/TRIO domain 0.0000332
Further Details:      
 
Domain Number 2 Region: 9-83
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.96e-17
Family CRAL/TRIO N-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012950   Gene: ENSXMAG00000012917   Transcript: ENSXMAT00000012966
Sequence length 328
Comment pep:novel scaffold:Xipmac4.4.2:JH557055.1:117132:125597:1 gene:ENSXMAG00000012917 transcript:ENSXMAT00000012966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINHVPPGLSSDTTEKARMELNENPDTLHQDIKQVRDMIVTRPDIGFLRTDDEFILRFLR
ARKFDHVETFRLLAQYFQFRQQNLDMFQSFKVDDPSIKRALMDGFPGVLEAPDQHGRKIL
ILFASNWDQSRNSFIDILRAILLSLEVLIENPELQINGFTLIIDWSNFSFKQASKLTPNI
LKLAIEGLQDSFPARFGGIHFVNQPWYIHAMYTIIKPFLKDKTRKRIFLHGNNLNSLHQL
IQPECLPSEFGGTLPPYDMGMWARTLLGPDYNDETEYTLTYDALHVRESCGGGGGGEKDM
MKRSQSTVEAAALRQMDRETSTPLLALD
Download sequence
Identical sequences M4AEQ6
ENSXMAP00000012950 ENSXMAP00000012950 XP_005811762.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]