SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013409 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013409
Domain Number 1 Region: 611-796
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.77e-54
Family DBL homology domain (DH-domain) 0.000000135
Further Details:      
 
Domain Number 2 Region: 800-934
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-35
Family Pleckstrin-homology domain (PH domain) 0.00000221
Further Details:      
 
Domain Number 3 Region: 313-427
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000121
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 4 Region: 1030-1085
Classification Level Classification E-value
Superfamily SH3-domain 0.0000126
Family SH3-domain 0.0035
Further Details:      
 
Domain Number 5 Region: 118-203
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000222
Family CRAL/TRIO domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013409   Gene: ENSXMAG00000013325   Transcript: ENSXMAT00000013425
Sequence length 1112
Comment pep:novel scaffold:Xipmac4.4.2:JH556698.1:1024510:1050457:1 gene:ENSXMAG00000013325 transcript:ENSXMAT00000013425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPASLQEERDLAKESAEMECYRCLLQAGSQLESTLQQVTVPLSMKEVGGYIEKQVAYLS
GGRGEDSSVIITLPECSAFSDIPEEALAKVFTYLTLIPRTRQPGVKFIIILDRRLDTWAS
IKTALARIAASFPGNLHLVLVLRPTSFFHRTVTDIGFRFSQDDFMLKMPVVMLSSVTDLL
RYIDENQLTSEFGGTLDYCHSDWIVLRTAIESFAVTVKDIAQMLQGFGTELAEAELPDEG
KAIEQLLETHTEKYKKLKDAIRSVSKEGRHLLSNLETTGKDDDSQWDVKLDWETVQRLLA
QLRDMESAFDGFFEKHHLKLHQYLQLLRYEQSFQEMELCLEHIMHQERELSINVNTLAQT
EQLLKRLNDLEANAQEVMSRAQIIILHGHQLSAGHHYAMGLIMQRCNELRHHCDTLSAAL
KSKHSFLMQTHQLLLCLGQAQTWCDDGAYLLANQLVDKSQSKEGAQMSLREIEKFLEGAP
SMLSSGHDILAIEYEAVITPQLQTQIGNVFEKHAAVQQMIQNRQASLRKLADKHVRPIQL
VAPRPENQPRSKSPLFSPKHGDGLKFTFDISLPGKKSSRKSPNPRKIEVIHDYQESRSCV
AYSLDGDDSPDFLKRHVMRELIETERIYVEELLSVLLGYRAEMDNPALSGLLPPILRSKK
DILFGNMPEIYNFHSSVFLQDLEGCLEAPETVGACFLQRKESFQMYEMYCQNKPRSEALW
RQFSDCAFFQECQKKLEHKLGLDSYLLKPVQRLTKYQLLLKELLKYSPDCEGTSELQGAL
TAMLDLLKSVNDSMHQIAITGYEGEICELGRVLMQGSFSVWISHKRGSTRMKELARFKPM
QRHFFLYERALLLCKRREDHGDGSEKTPSYSFKHCLKMTAVGITENVKGDVKKFEIWYSG
REEVYVVQAPTVEVKMTWLNELRRILTNQQKLLRDEAYQHGPVAEHMQLSPSLTESKQQR
ASVSSEDTESGRSSPEPQSHSPKHQPNRRSWPGAHHSVDICEGLEEWPGDQDAFLPSETE
EKNMVKLTPGKYRAMADCPQNGPGSIIIKRGDVIHLQCEDNRGRWLVKNLSRQQEGFIAA
ASLQLIIGSSSHERSPRLGDPRNLKVRKLSSP
Download sequence
Identical sequences M4AG15
ENSXMAP00000013409 ENSXMAP00000013409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]