SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013446 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013446
Domain Number 1 Region: 229-424
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-47
Family DBL homology domain (DH-domain) 0.000000185
Further Details:      
 
Domain Number 2 Region: 417-543
Classification Level Classification E-value
Superfamily PH domain-like 8.31e-31
Family Pleckstrin-homology domain (PH domain) 0.000027
Further Details:      
 
Domain Number 3 Region: 160-227
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-24
Family SH3-domain 0.0000629
Further Details:      
 
Domain Number 4 Region: 1-113
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.86e-24
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013446   Gene: ENSXMAG00000013408   Transcript: ENSXMAT00000013462
Sequence length 772
Comment pep:novel scaffold:Xipmac4.4.2:JH556698.1:1491168:1532565:1 gene:ENSXMAG00000013408 transcript:ENSXMAT00000013462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEEQTVTWLISLGVLSSPKKNIADPEEFLKTSLKDGVVLCKLTERLIPGFTPKYSQDP
RTEADCISNIKEFLRGCSSLKVEGFEPEWLYTGENFGKVLNTLLAFNFATQDCAVERCPQ
SGSSSPNQTTSSHALSSTRSKGSLRRQSKSVEMSENGGGGQVMVKARFNFKQNNEDELSF
SKGDMIIVTRQEDGGWWEGTLNSKTGWFPSNYVREIKPCEKPLSPKGTPLTKNYFSVVVQ
DILEHEREFVKELQTVLTCYLRPLQANDKLSSGDSATLCGNLEEILTFQQGLCLALEDCT
KVAEGQQRVAGCYLNLMSQIKSLYLTYCSSHPSAVCILTDHSEELGKFIESQGASTSGIL
TLTTSLSKPFIRLDKYPTLLQELERHVEEAHPDYADIIKATAAFKSLVSQCQDLRKRKNL
ELQILSEPVRGWEGDSMKSLGQVAYMSLVHVRNGASEEKEERYLMLFPNVLVMLSASPRM
SGFIYQGKLSLTGTTVTRQVEDGENTPHAFDITGGMIDRFSVFCSSAQELQEWLEHLQPY
TKSGSPAGTISKTANGKPLSAVGTPTHLPHLSGPSAVSRGPLEPPKTSKPWTLSCLRPAP
PLKPSAALGYKERMSYIMKDSSKSPRPIKKFLPGNRKKDRKPSDDEFQIRKSTAALEEDA
QILRVIEAYCTGASLHQTTTAVRKECVPQVLLPEEEKIIVEEIKSNGQTVTEEKSLVDAV
YALKDEVHELKKENKWMKQFLEEEQKSRKELERLVRKLSKQKNDCGWEDSSH
Download sequence
Identical sequences M4AG52
ENSXMAP00000013446 ENSXMAP00000013446 XP_005799618.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]