SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013585 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013585
Domain Number 1 Region: 2762-3012
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-69
Family Protein kinases, catalytic subunit 0.00000379
Further Details:      
 
Domain Number 2 Region: 1957-2159
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-53
Family DBL homology domain (DH-domain) 0.0000123
Further Details:      
 
Domain Number 3 Region: 1295-1473
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.15e-50
Family DBL homology domain (DH-domain) 0.0000000119
Further Details:      
 
Domain Number 4 Region: 1480-1599
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-33
Family Pleckstrin-homology domain (PH domain) 0.000000834
Further Details:      
 
Domain Number 5 Region: 2161-2284
Classification Level Classification E-value
Superfamily PH domain-like 3.57e-31
Family Pleckstrin-homology domain (PH domain) 0.00058
Further Details:      
 
Domain Number 6 Region: 2659-2753
Classification Level Classification E-value
Superfamily Immunoglobulin 3.77e-23
Family I set domains 0.013
Further Details:      
 
Domain Number 7 Region: 1106-1245
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-21
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 8 Region: 310-447
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-20
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 9 Region: 858-1011
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-19
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 10 Region: 526-673
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 11 Region: 1646-1736
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000637
Family SH3-domain 0.003
Further Details:      
 
Domain Number 12 Region: 2522-2586
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000761
Family SH3-domain 0.00015
Further Details:      
 
Domain Number 13 Region: 210-273,306-341
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000301
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 14 Region: 53-201
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000706
Family CRAL/TRIO domain 0.009
Further Details:      
 
Domain Number 15 Region: 678-785
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000249
Family Spectrin repeat 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000013585
Domain Number - Region: 748-856
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00173
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 452-566
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00264
Family Spectrin repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013585   Gene: ENSXMAG00000013528   Transcript: ENSXMAT00000013601
Sequence length 3079
Comment pep:novel scaffold:Xipmac4.4.2:JH556908.1:64463:146957:-1 gene:ENSXMAG00000013528 transcript:ENSXMAT00000013601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGEGAEETTKDAGDIEAFFKTDGSLPKEPKGEVSSQIAGFRRNEEMRAMEVLPILKEK
VAFLSGGRDRRGGPVLTFPSRSNHDRIRADDLRRLIAYLACIPSEEVCKHGFTVIVDMRG
SKWDSIKPLLKILQESFPSCIHVALIIKPDNFWQKQRTNFGSSKFEFETVMVSLEGLTKV
VDPSQLTADFDGSLDYNHEEWIEVRVAFEEFSGHATQMLTRLEEMQETVSRKDFPQDLEG
ARRMIEEHAALKKKIIKAPIEELDTEGQRLLQRIQSSEAFSNRNGSTGGSSSSSSGGSGG
VCNADTQGLVPRITQLLDKLHSTRQHLHQAWHVRKLQLDQCFQLRLFEQDAEKMFDWIMH
NKGLFLAGYTEIGNNHPHAVELQTQHNHFAMNCMNVYVNINRIVSVGSRLLESGHYASQQ
IKQISGQLEQEWKAFAAALDERSTLLEMSASFHKKCDQYMSNVDSWCKACGEVDLPSELQ
DLEDAIHHHQGLYEHITAAYSEVSQDGKALLDKLQRPLTPGSADSLTASANYSKAVHHVL
DIIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGK
SLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQD
FVRRVEQRKVLLDMSVAFHTHVKELWTWLEELQKELLDDVYAESVEAVQDLIKRFGQQQQ
TTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIESVLQQLDEAQAQMEELFQER
KIKLDLFLQLRIFERDAIDIISDLESWNEELTGQKSDFDTEDLTMAEQRLQHHADKALTM
NNLTFDVIHQGQELLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQRELDLAAEQ
HRRHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIE
KTHQSALQVQQKAEALLQANHYDMDLIRDCAENVASHWQQLMLKMEDRLKLVNASVAFYK
TSEQVCSVLESLEQEYKREEDWCGGADKLGPNCETDHVSPMISKHLEQKEAFLKACTLAR
RNADVFLKYMHRNSVNMPGMLSHVKAPEQQVKNILNELLQRENRVLHFWTMRKRRLDQCQ
QYVVFERSAKQALEWIHDTGEFYLSTHTSTGSSIHHTQELLKEHEDFHITARQTKERVKL
LIQLADGFCEKGHSHAAEIKKWVTAVDKRYRDFSLRMDKYRSSLEKALGIPSDSNKASKD
LQLDIIPANPPGSEVKLRDAAAHEPNEEKRKSARRKEFIMAELIQTEKTYVRDLRECMDT
YLWEMTSGVEEIPPGIINKEHIIFGNMQDLYEFHHNIFLKELEKYEQLPEDVGHCFVTWA
DKFQMYVNYCKNKPDSTQLILEHAGNYFDEIQQRHRLANSISSYLIKPVQRITKYQLLLK
ELLTCCEEGKGEIKDGLEVMLNVPKKANDAMHLSMLEGFDENIESQGELILQDSFQVWDP
KTLIRKGRERHLFLFEMSLVFSKEVKDSNGRSKYIYKSKLFTSELGVTEHVEGDPCKFAL
WVGRTPTSDNKIVLKASNIENKQDWIKHIREVIQERTIHLRGALKEPIHIPKPSTAKHPK
GRRDLEDLDSQGEGSSQPDTISLASRTSQNTLDSDKLSGGCELTVVIHDFMASNSNELNL
RRGQTVEVLERCHDKPDWCLVRTTDRSPALEGLVPCAMLCIAHSRSSMEMEGIFNHKDTL
SVCSNDSIMPGSSATLQPGHGIGSHSSPGPKRPGNTLRKWLTSPVRRLSSGKADGHVKKL
ASKHKKNREVRKSGEITMGSQKDSDDSAATPQDETLEERVRNEGLSSGTLSKSSSSGMQS
CGEEEGEEGADSVPLPPPMAIQQHSLLQPDSQDDKTSSRLSVRPSSSETPSAAELVSAIE
ELVKSKMALEDRPSSLSVEQGDSSSPSFNPSDNSLLSSSSPGEEMDERRASIVKKRHYVL
LELLETERDYVRDLALVVEGYMSRMKEEGVPDDMRGKDKIVFGNIHQIYDWHKDFFLREL
EKCLEDPDRLGLLFLKQERRLNMYVVYCQNKPKSEHIVSEYIDTYFEDLKQRLGHRLQIT
DLLIKPVQRIMKYQLLLKDFLKHSKKAGLECPDIEKAVEVMCIVPKRCNDMMNVGRLQGF
DGKIVAQGRLLLQDTFMVSDPDGGPHGRMKERRVFLFEQLVIFSEPLDKKKGFSLPGFLY
KHSIKVSCLGLEESEEGDPCKFILTSRSTNGTLESLVLHSSHPGVCEVWTLQISQILESQ
RNFLNALTSPIEYQRNHVGAGVGAQGGCVGGVSPTSSAPSGPQSVSRRPSKIPQPSRLPQ
PLRHLTGADAEGPNKMLGLSPRPVPATPLPPGGSPQGKRPLQTAEDQTHTQTLTPANTVT
PIPRATVGPLPSTPTSKPRPGAVSPIAPTPAATAFGKDALPPPPSQPQKTGSGFWSSMPA
SPASRSGSFTFPGEAAETPARQPGVQAHRHSTHSKEADRMSTCSSASEQSIQSTQSNGSE
SSSSSSVSTMLVTQDYMAVKEDEISVSQGEVVQILASNQQNMFLVFRAATEQGPAAEGWI
PGFVLGHTSAIVPDSSDGPISRKSSSWHTSLRIRKKSEKKDKEVKKETKLENGYRKSRDA
MANKVSVKLLNPNYIYDAPPDFLVPLSDVTCDNGESVTLRCKVCGRPRATVTWRGPNESN
LTNNGHVTIAYNDAGEATLRIIGATAEDDGVYTCVATNELGSVTSSASLRVLAVSTDGLR
VSWKDNFESQYTEVAELGRGRFSVVKRCDHQGSKRTVAVKHVNKKLMKRDQVTQELNLLQ
RLQHPHIVSLVDTFETPSSYAIVLEMADQGRLLDYIVSWGNLTEEKVASYLQSVLEALHY
LHNCRIVHLDVKPENLLVAHNASAQPVVKLTDFGDAVQLNSAHYVHPLLGSPEFASPELV
LGEPVSLTSDLWSLGVVTYVLLSGASPFLDESAEETCLNICRLDFSFPRDYFHGVSQAAR
DFVRLLLRTDVEYLTVSVPNPRGRRWLRPAPPGDGRGRGEGCLDTARLISFIDRRKHQTD
ARPIGGVRSFIQSRLQSRI
Download sequence
Identical sequences M4AGJ1
ENSXMAP00000013585 ENSXMAP00000013585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]