SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013602 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013602
Domain Number 1 Region: 1225-1447
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-63
Family DBL homology domain (DH-domain) 0.00000000617
Further Details:      
 
Domain Number 2 Region: 1447-1587
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-31
Family Pleckstrin-homology domain (PH domain) 0.000000243
Further Details:      
 
Domain Number 3 Region: 211-311
Classification Level Classification E-value
Superfamily EF-hand 3.08e-29
Family Eps15 homology domain (EH domain) 0.0019
Further Details:      
 
Domain Number 4 Region: 1601-1721
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.22e-26
Family PLC-like (P variant) 0.0086
Further Details:      
 
Domain Number 5 Region: 10-106
Classification Level Classification E-value
Superfamily EF-hand 1.42e-26
Family Eps15 homology domain (EH domain) 0.0021
Further Details:      
 
Domain Number 6 Region: 1147-1227
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-26
Family SH3-domain 0.0000619
Further Details:      
 
Domain Number 7 Region: 988-1064
Classification Level Classification E-value
Superfamily SH3-domain 6.83e-21
Family SH3-domain 0.00014
Further Details:      
 
Domain Number 8 Region: 741-822
Classification Level Classification E-value
Superfamily SH3-domain 1.1e-20
Family SH3-domain 0.0000987
Further Details:      
 
Domain Number 9 Region: 886-972
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-19
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 10 Region: 1080-1155
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-17
Family SH3-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013602   Gene: ENSXMAG00000013547   Transcript: ENSXMAT00000013618
Sequence length 1728
Comment pep:novel scaffold:Xipmac4.4.2:JH556928.1:361114:408940:-1 gene:ENSXMAG00000013547 transcript:ENSXMAT00000013618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTAFTGQYDVFLITPDERAKHDQQFHGLAPSAGGYITGDQAKNFFLQSGLPPPILA
QIWALADMNSDGRMDIHEFSIAMKLIKLKLQGHPLPPTLPPSMKQPPPLSLPPQASFGMP
PMAPIPTPIPAPLPVVPPLPLPPLPVGVSPPLVSSAPPPLPPPIANGAPPTAMMPPISGF
PHSAPSVNKTSSFNRSSTKLQKGSSFDVAGTQPPSDWAVPQSSRLKYRQLFNSHDKMMSG
YLTGPQARTILMQSSLPQSQLATIWSLSDIDQDGKLTAEEFILAMHLIDMAMSGLPLPPV
LPADYIPPTFRRRVRSDSVQSDQKSVPEETEEENEINLEKKLPVTFEDKKRENFERGNLE
LEKRRQALQEQQRKEQERLAALEREEQERKERERLEQERRRQQELEKQLERQRELERQRE
EERRKEIERREAAKRELERQRQLEWERQRRQELLTQRNREQESIVLLKARKKTLEFELEA
LNDKKNQLEGKLKDVRFRLSTQRREMEQTNQTRETRIAEITQLQQQLQDSQQWLGRLIPD
KQNLNEQLKQVQQNSLHRDSLSSLQKAIEQKENSRQQLKEQLDSVERETRAKLLEIDAFN
TQLKELREIHSRQQRQKQKELEGGAQSLSQPYIQTAIERKSAELQEEGPASVSASHAWLN
RVTQEEEERKRRGMEEEEEGRKGAGSVEEKDVESRGKKDMQDKLNKLFSQPADPWVSAAL
WTTSEKKASASGFEQQKQQKPVKVVYYRALYPFDARSHDEISIQPGDVIMVDESQTGEPG
WLGGELRGRTGWFPANYAERIPESEAPVSLRPSSSATPPSTQQPMATPPSATGHTSTSTS
SANSNWADFSTTWPSSTASQSDSEGWDAWPTSSANQNPSLSVPSAQLRQRSAFTPATMTT
GSSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNEIITVLEQQDMWWLGELQNGQR
GWFPKSYVKLISANMTIPSPSEAGISESPPNGKRPSSSPAKSSESGEEYVAMYTYESNEQ
GDLSFQLGDIVVVTRKEGDWWTGMVGGKTGVFPSNYVKPRDSVPESLGPAGKTGSLGKKP
EIAQVIAAYTATGAEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLL
SPSTSKTTPTEPTPPKLAPASTALCQVIGMYDYVAQNDDELAFQKGQVINVLNKDDCDWW
KGELNGREGLFPSNYVKLTTDTDPSTQWCADLHLLDMLSPMERKRQGYIHELIVTEENYV
NDLQLVTEIFHKPLLECELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGDRMPVK
MIGDILTNQLPHMQPYIRFCSCQLNGATLIQQKTDDNPEIKDFLKRLAMDPRCKGMPLSS
FLLKPMQRVTRYPLIIKNTLENTPESHPDHSHLKAALEKAEELCSQVNEGVREKENSDRL
EWIQAHVQCEGLSEQLVFNSVTNCLGPRKFLHSGKLFKAKSSKELYGFLFNDFLLLTQVT
KPLGSSGSDKVFSSKTHLQYRMYKTPIFLNEVLVKLPTDPSGDEPLFHISHIDRVYTLRA
ESINERTAWVQKIKAASELFIETEKKKREKAYLVRSQRATGIGRLMVNIVEGIELKPCRT
HGKSNPYCEVTMGSQCHITKTVQDTLNPKWNSNCQFFIKDLEQDVLCITVFERDQFSPDD
FLGRTEIRLAEIKKDQGSKGPITKRLLLHEVPTGEIVVRLDLQLFEEP
Download sequence
Identical sequences M4AGK8
ENSXMAP00000013602 ENSXMAP00000013602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]