SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013654 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013654
Domain Number 1 Region: 93-309
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.26e-61
Family DBL homology domain (DH-domain) 0.0000000659
Further Details:      
 
Domain Number 2 Region: 294-449
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-45
Family Pleckstrin-homology domain (PH domain) 0.00000228
Further Details:      
 
Domain Number 3 Region: 6-88
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-19
Family SH3-domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013654   Gene: ENSXMAG00000013619   Transcript: ENSXMAT00000013670
Sequence length 516
Comment pep:novel scaffold:Xipmac4.4.2:JH557724.1:40757:53775:1 gene:ENSXMAG00000013619 transcript:ENSXMAT00000013670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVNPQLISDGSVVYAEGLWDHVTMDVQELGFKAGDTIEVIDATNKEWWWGRIIDSEGWFP
ASFVRLRVNQDEPMEQLSTHLEESQCGDEDGADLSPGLPCKEQMRANVINEIMITERDYI
KHLKDICEGYIKQCRKRTDMFTEEQIRTIYGNIEEIYRFQRKFLKSLEKEFNKEQPHLSE
IGCCFLEHQTEFQIYSEYCNHHPNACNQLSKLMKVNKYVYFFEACRLLQKMIDISLDGFL
LTPVQKICKYPLQLAELLKYTNPQHRDYKDVEAALNAMKNVASMINERKRRLENIDKIAQ
WQSSIEDWEGEDVLVRSSELIFSGEITKLSQPQTKSQQRMFFLFDHQMVYCKKDILRRDI
LYYKGRMNMDLMEVTDLEDGKEKDFNITVKNALKLCARSGNEVHLLCTKKPEQKQRWLRA
FADERKQVQNDCETGFSLTEIQKKQAMLNAFKSHPAGKSKVAMMCTVTRPYCDFLLHQKH
PSLPTALPQQQLFMMAEPKRKTTFWHNIGRLTPFKK
Download sequence
Identical sequences M4AGR0
ENSXMAP00000013654 ENSXMAP00000013654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]