SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013724 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013724
Domain Number 1 Region: 85-151
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000404
Family SAM (sterile alpha motif) domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000013724
Domain Number - Region: 789-887
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00393
Family Extended AAA-ATPase domain 0.069
Further Details:      
 
Domain Number - Region: 1320-1385
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0804
Family DBL homology domain (DH-domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013724   Gene: ENSXMAG00000013701   Transcript: ENSXMAT00000013740
Sequence length 1673
Comment pep:novel scaffold:Xipmac4.4.2:JH556990.1:43962:52629:-1 gene:ENSXMAG00000013701 transcript:ENSXMAT00000013740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPERKQSSSPSLSMMTDQSKDDFVNFAVDERNSQSSVVDEINTSPTDPSLRSYRSRSPP
PDFSNAIGGLPTKTVDHNLTLPPLIEDWTKDQVKDWLVIKLRVPKELAQKLYDQELTGAY
LASYEKEDLLELGVPPAPAIHILRQVKKFKKQSETFVPATQAAESELNFRDNVEMSRKLD
ESAENETVSSDSGIQNLSSSVWMLQMTRDVIRVDPTIAESQIDIQTPDNLEAPQRQRPVC
QIRPFDKSNSSVFYMENDILPPMAGPSNLIDPVHEYHLLPNVNEASEREILYEFNREVFS
FAASCMNSRTNGTIHFGVNVQQAQQHGQVVGQTITSLNKYNEAFESSLGDFFEEKYVNVA
RLCIRPPNFIQVLHENGTASDKWVIEVDVVPVISQTQNYLFYTKLGITSTEEKECKTFCL
FVREGPRSVNIFADTNPRVGQEKLKDLTEKVKNLVSARKAAEENKERCFPQSYQGQRLKQ
LMTRGRHVLESSLQVIVVTDKCHPDQLEHMDFLKEISLFAVLEFDPESDLNGTCHFYRKD
HIANLHYPQMFNTQDCLPTLLGKLNLFKQTSWIFCNGRLNEESEEDMPLISSEWLKRRSG
DISKMIGFLCSPDVISKDRLLVILVLHSAVTDLSHPILETFCAIYRTLEGADNMLCICRD
SGVFNDWKKLIELRCKEDISSKCIYELSLNEISSTIKQLKEPQTQSSQRYLPSTGSSLVL
LTKKAEELFTDLDILSKNECENTEIEKSDSFDEFNKKIEEDFYRGGQVRWWNFHLSEQRG
SLPFIKRDKYNELYDLITPVEGYTSSCVMINLFHPPGCGGTTLAMHVLWNLRRKFRCAVV
KNNRATNNDIAAQVINLLTYGKQDQPGYTPVLLLVDNWEDVEDLKQCILHVAGERRQQNA
LMVLILNCERTQFPDESSRSSYVPNIFITNKLSTKEQGLFSEKLQQLKTYHEKPETFYAF
MIMTNNFSEAYITNIVSNSLKALDATSRQGRLLSFLALLNTFVNGSYMSLSLCEELLGIR
NSLWKRETIDDSMTPYSTLLITFSVEEQGFYQAVRFLHPMIASNCLQIFEQRHQLSLAEV
TIDILHSDKLYKSCMGKDFLVQNIQSMLISRHRKEQGDDKDTQFSPLIEKIHNKEGAEKV
EELFEKAIGRFDRSATLPQALARYFCLREKDFQAALKWALDARGKNSNSYIADTVGQVYK
SQLKKKIEDSEPLTAEALNECLILGSKAAKAFQESQELAKKDETIDPFDLHNRKRTKSYN
TSGYVGETEVMMILLDFIKELPLSQSRDRYQTDILLQILKGHHTIRDFHFDHSNAATAQF
VDVLECHERFLISLKPRLKEIFSFFENYFTYLRPRSQERVTADDRNKKKLSEHFKQYLKI
FSSSEQEKASEKARNPNLSLLQDIQDQRFYLETKRADSFAGLLQCLSDKNVTEMERIFKK
WKFIFEKSPKRSVSDTVNFILANIVMHSIKPSSKELKKYEELVDLLNEELQKEGTRSNST
EMYYLSMLLMWPTKDRKLESLSTYKDIATYFRSAKKSFHRRFSHMFPVRTAVAHFFLGKS
SRLNRIVSKVVLDQILREESCSDQSGQSCTLNHLWQSGAAWNEPQVKKELLRVKGISENG
EISVNYGGNLKIPVRPAYLGDIRSGCSREQISFYLGFTMEGPVAYNIKYLTAQ
Download sequence
Identical sequences M4AGY0
XP_014328665.1.87360 ENSXMAP00000013724 ENSXMAP00000013724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]