SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013882 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013882
Domain Number 1 Region: 400-467,517-553
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-19
Family Second domain of FERM 0.0072
Further Details:      
 
Domain Number 2 Region: 3-102
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000402
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 557-644
Classification Level Classification E-value
Superfamily PH domain-like 0.000000252
Family Third domain of FERM 0.082
Further Details:      
 
Domain Number 4 Region: 300-391
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000127
Family Ras-binding domain, RBD 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013882   Gene: ENSXMAG00000013854   Transcript: ENSXMAT00000013899
Sequence length 668
Comment pep:novel scaffold:Xipmac4.4.2:AGAJ01041289.1:9582:20919:-1 gene:ENSXMAG00000013854 transcript:ENSXMAT00000013899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVEKGWLLREVGGSWIKHRRYWFVLSQDSLDYYTGPEKGARRLGTLVLTSLCSVIWPDKQ
TYKEAGYWSITVYGRKHCYRLYTKHFNEAVHWACAIQKIIDTKSPVETPTQLLIRDIEEN
KFNPEVVEHIYQHNAILKYTQGPLYAPLLPFPYGNLEHTYHNGKGYGSVREEAVKLFNCL
QQLESAREPIPIIQGVLQTCLDLRPLRDEVYCQLVKQTSHTPSPNTAAHLRYWQLLTCMS
CTFLPGSTVLKYLRFHLKRIQSQSPESEMDNYASFISEALEKTKCRECVPSWEEIQMLMN
RQEMLCTVHHPGPGSCQLYISSHTTANEVVRRMQEKLGLQDSKNTFALYEQNALWEQPVT
GNSLIADVLTRYESFTTKESESQSQWKLCFKLYCLLDADSISVDSIEYLFLFEQCHEMVV
RGQLPACEEDLLSLAALRLQSLMGDFSTHSPFPPLDELFPGHMLETRVLMSLSAPQAAPP
CQRFPTGLLAGTLWSHSATVAHKQKMENDKRLRSRLKEEAAVVTTAILERWKGLAGYSSR
DSMAAYLTIARQWSGFGCTLYEVDFYISSKGNFSQKLWLGVAATSVSIYKQGESEALESF
PYGQICSYGVSDSNTFKITAGDRDLIFETSKLTEIMQLMNAYFSAIHRQRGTLTHTPSHH
PPSHGEVQ
Download sequence
Identical sequences M4AHD8
ENSXMAP00000013882 ENSXMAP00000013882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]