SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014083 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014083
Domain Number 1 Region: 1382-1574
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-44
Family DBL homology domain (DH-domain) 0.0000238
Further Details:      
 
Domain Number 2 Region: 1583-1697
Classification Level Classification E-value
Superfamily PH domain-like 2.9e-36
Family Pleckstrin-homology domain (PH domain) 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000014083
Domain Number - Region: 724-879
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0405
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014083   Gene: ENSXMAG00000014049   Transcript: ENSXMAT00000014102
Sequence length 1846
Comment pep:novel scaffold:Xipmac4.4.2:JH556781.1:609344:634028:-1 gene:ENSXMAG00000014049 transcript:ENSXMAT00000014102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPRAKSRSCDNYLSIKDAESLDNCIQSTLSALYRPFSATASTVLWQLFSVVERQYRGDG
LRCLIDFLLPAKRILQIVQKESCVKFRGLLFYHEGWPLCIHEKVVLQLAPLHKVRLKQGD
FYFQIVPLGRKAAKLVIKCLSASGQAIAEIPIPESMYGSIFTAELLQNVTRDRNLHPLQN
CLLTSGTAVYKTPWKNVVNPLFVSSTADAIMQARCSSRGSFRGHLSTCSTSGSTGTLDSH
RSSRESLVSLGADSIFSEPTSPKTNHKDSSGENQRVCRDKTVAPIITIEGHVEEFEHLTW
KFGSRSWLSSDDSRPNTPLFYLQKGLRSAERRSDRRSKSLERTNKAGQVKGHRERSSSGG
STSVSPKKLMNGYTLRFGKLDVEAVFNGNEKRSSKEDSGLLHNSNYAHSGRHVWPYPGKK
SAMGGTGKQRCEGPTSEIVLFLNYAGSSVNCERALKTVCVLLNIWMRPGILLRETFPDER
ITVDHLKHCSKSTSLLPRLYFSVCIASFLTVVPSFTKVSFVSQTVTGDPGKCAANTDLVT
QSHRKCTNCLKTIEADHGGFTVTEHNRTTLEASVWLKRQQVYTKVHTSYWYQDTPRFLKS
YSFKIEQLFFHIAHSKIHSDQSFLLLCSTSEFPLNFLLTTFPKITSNSPQITTSSRVQGT
FVLISTGQRTDSVSSDIRRHKTNVEESHSPKDENGITLNPGSAQKSSCDYNPAFPKLMSE
INQELLTSRAVILAGNRDRGGRPVLQVCTRAEVWALDTCRVSDVTCLLGYYHSTLRKERR
DQGLAVIIDSRKQQPVPTLLSSLFEFQALVPNALYSILFLVDKDGSAKLDRDFGVQIETL
SSLKALLKHIDQTQLTRDLEGTYHYDHNHWIGFRQKIEPFASSCSAAISFLQESIRTLSV
SGDLKTSQEVSEVLEQQRHLMKSVLDDTHLNRLRLEGGTVLARIRKEEACENENYRDAIE
MLNALYNQVDEEVHKLVILSNKSQKELEDLLELHKFEEQTQQIKRWFSVEGEKHLLPLES
VTLSTDKIKEMKESLEQFLEDSVESCCGRHEESVSYLQYYLDKENKRLKESAACNFKQRL
GSILSRVQERKAKLEVLTNLYEFYDSAYAFVLQDYFHQLSLDGPDQTFSPSVVKILQDYC
TEASKFSMDNFSTLNNMVLLLECPQQLQQWNSMWHKCQKTKRQLEATLARASLSDQNPSA
VGTGDSLPAAESCVVPLELPRANGCLHLPGAITSLTFEDSKSLSAESFSRSPSGSISSPS
HFTFPVDREDKLGQSSCTLDDTDSDCTIDSTVSCHSEPVYSKATRLRKHPMKKIMKKTMS
YELTPRDGGHSDISHVHGYTGVYIKGLEVANNVSAEKKLLRPDVTSPVLGRSRSLSTPSR
THNRRSEGDGKKQSSKVQHIMDEMISTEREYVRSLSYIIEHYFPEMERLDLPQDLRGKRS
IIFGNLEKLWDFHSQYFLKELEASAHSPLSISSCFLRHEDQFGMYALYSKNKPQSDALLS
SHGHEFFKNKQLELGDKMDLASYLLKPIQRMSKYALLLKDLIKECSYSQEQELSDLRTAE
EMVRFQLRHGNDLLAMDAIRGCDVNLKEQGQLRCQDEFIVWCGRRKYLRHVFLFEDLILF
SKTKKIEGGYDIYIYKQSFKTAEIGMTENVGDSGLRFEIWFRRRKSQDTFILQASSAEVK
AVWTAIIGKILWRQALRNRELRMQEMVSMGIGNKPFMDIKPSDAAISDRAIDFIMKGTEC
RTRASIAVSSFEHCAAFKRPHSTISNSSTSSSSSQSSSSLLGSLNLHLYSSPSHPHPYLY
PMGSVASFAQWPYDCIEEDELEQDVVSSRPSMITESSETSSSQCNS
Download sequence
Identical sequences M4AHY9
ENSXMAP00000014083 ENSXMAP00000014083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]