SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Xiphophorus maculatus 69_4.4.2 > ENSXMAP00000014103

Domain assignment for ENSXMAP00000014103 from Xiphophorus maculatus 69_4.4.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSXMAP00000014103
Domain Number 1	Region: 90-191
Classification Level	Classification	E-value
Superfamily	Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain	1.06e-31
Family	Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain	0.0014
Further Details:

Domain Number 2	Region: 34-77
Classification Level	Classification	E-value
Superfamily	Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain	0.00000000759
Family	Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain	0.018
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSXMAP00000014103 Gene: ENSXMAG00000014074 Transcript: ENSXMAT00000014122
Sequence length	236
Comment	pep:novel scaffold:Xipmac4.4.2:JH557151.1:192097:193635:-1 gene:ENSXMAG00000014074 transcript:ENSXMAT00000014122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MPIYKPFRKTLPPSVQKDKDSQKCGLRHTVYSVCGNEYTGEWLENQKHGNGIQVWKKAGA IYHGEWKYGKRDGYGTYSVQIPETKEYTRKYCGQWKNGKKHGYGTYFFDSSAVYEGEWAD DQHNGWGRMYYENGDIYEGEWLNHKNHGRGIIRFSNGNWYEGSWRDGKRNGDGKFYYSDK GLLYEGFWVDGIAKCGTLVDVGRESAPSPPEFPFPKIQLVDMELVLREARAACQCH
Download sequence
Identical sequences	M4AI09 ENSXMAP00000014103 ENSXMAP00000014103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]