SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014204 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014204
Domain Number 1 Region: 442-913
Classification Level Classification E-value
Superfamily Ras GEF 1.31e-131
Family Ras GEF 0.000000000000454
Further Details:      
 
Domain Number 2 Region: 70-271
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-36
Family DBL homology domain (DH-domain) 0.0000000533
Further Details:      
 
Domain Number 3 Region: 290-436
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-30
Family Pleckstrin-homology domain (PH domain) 0.00000484
Further Details:      
 
Domain Number 4 Region: 1-48
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000658
Family TBP-associated factors, TAFs 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014204   Gene: ENSXMAG00000014141   Transcript: ENSXMAT00000014223
Sequence length 1199
Comment pep:novel scaffold:Xipmac4.4.2:JH557320.1:34157:48052:1 gene:ENSXMAG00000014141 transcript:ENSXMAT00000014223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAVLEYISADILKLAGNYVRNIRHDDITKQDITVAMCADKVLMDMFHQDEEDMGLFPLL
DEEPSANEEQRYCDLVRSFLADGHQYPRQLHLLLKVFREPFASCPALFSTQDVDSIFGRL
ADIQEVTVKLLGLLEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYEAYAQEVLHPAFHD
HFLDLVTKPGASVHLQSICEGFKEAVRYVLPRLLLTPVYHCLHLLDTLKQLEERSEDEED
KECLRQAITALLNLQSSLERICSRSLAKRRLSEPACRLHSQQVKSKHLAIRRMKDVQRSI
DGWEGADIVQCCNEFIMEGTLSRVGAKHERHIFLFDGLMISCKAGHAPPRLPGAAAAEFR
LKEKFLMRKVRVVDREDRDGEWRHAFEVAPKDGGGVLFAAKSAEEKNGWMAALVSLQYRG
TLERMLDQALLQDEEQQMRLPSVQRYRFAEPDSDQNVVFEDSVQSKSGIPVIKAGTVLKL
IERLTFHLYADPNFVRTFLTTYRSFCRPGELLDLLVERFDIPEPAPAESDPTDGLEQLLS
ADLKRFRKEFVQPVQLRVLNVCRHWVEHHFYDFERDPSLLSRLEDFIASVKGKAMRKWVE
SITKIIQRKQQVQVSQASPPPSITFQNSPPPIEWHLCRQGAVETFDLMTLHPIEIARQLT
LLESDFYRAVRPSELVGSVWTKEDKELHSPNLLRMIRHTTNLTLWLEKCIVETENLEERV
AVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQRKILEEAHELSE
DHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPDFLRRHGKDLINFSKRRKVAEITG
EIQQYQNQPYCLSVEPDIRKFLENLNPMEDLSEKDFADHLFNKSLEIEPRNTRSLPRFVK
RYTCPLKSPGIRPTSARVGSMRHPTPLQNEPRKISYNRVTDSESEGGVISAPNSPRTPLT
PPPASAASSSTDVGSVFDSPQGPSSPFHSTCDSIFAVISLPHGPRSSSVSSMVSFSRTSE
DAAIPPPVPPRRRPESAPSESSPTKVQSALESPPAVPPRQPTCKLLPPRYSSLSSSPPDS
PPLLPPREPLSSPLHLLPPPQGRSRCEVLSQAFFPSSSSSSLSSAPAPLTSSPPLTPTGR
KMPFPSPPLDGPPVPPRHSVPKLPPKTYKRESLSNVPPAGHAPCSAVGHLVKEAELETL
Download sequence
Identical sequences M4AIB0
ENSXMAP00000014204 ENSXMAP00000014204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]