SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014343 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014343
Domain Number 1 Region: 207-350
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-40
Family Third domain of FERM 0.00000198
Further Details:      
 
Domain Number 2 Region: 98-206
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-37
Family Second domain of FERM 0.00000181
Further Details:      
 
Domain Number 3 Region: 11-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.99e-24
Family First domain of FERM 0.000015
Further Details:      
 
Domain Number 4 Region: 498-592
Classification Level Classification E-value
Superfamily Moesin tail domain 2.62e-16
Family Moesin tail domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014343   Gene: ENSXMAG00000014297   Transcript: ENSXMAT00000014363
Sequence length 592
Comment pep:novel scaffold:Xipmac4.4.2:JH557186.1:189673:206594:-1 gene:ENSXMAG00000014297 transcript:ENSXMAT00000014363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILGLKKKQPKTFKVKVVTMDAEMEFSCEVKWKGKDLFDLVCRTVGLRETWFFGLRYTV
KDTYAWLKQEKRVLDQEVPKDSPITFHFLAKFFPEKVEEELVQEITQHLFFLQVKKQILD
EEIFCSPEASVLLASYAVQAKYGDYDPNFHKPGFLAQDELLPKRVLMQYQMTADMWEEKI
TAWYAEHRGIARDEAEMEYLKIAQDLEMYGVSYYAITQNKRDTDLLLGVDAQGLHIYNPN
NKLNPNKSFPWSGIRNISYSEKEFTIKPLDKKKDVFKFYSSQLRVNKLILQLCIGNHDLF
MRRRKVDSIEVQQMKAQAKEEKARKKMERQILAREKQMREDAERAKEEMERRLFQLQDEA
RLANEALLRSEETADLLAEKAQIAEEEAKLLAHKAAEAEQERQRLEVTAMKTKEEKRLME
QKMREAEQLAVKLVEQSERRLKEADHLKQDLTEAKDAERRAKQKLLEITKTTYPLIAAYS
APPAPPEAADFSYDSSSSRLDFKDSDMKRLSMEIERERLEYMEKSKHLQDQLKELKSEIE
SLKLEEQQQQQQQASMYSLPGEARGYVPEPAYLPHSNRNSAYMSQMAFFEEV
Download sequence
Identical sequences M4AIP9
ENSXMAP00000014343 ENSXMAP00000014343 XP_005813139.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]