SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014517 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014517
Domain Number 1 Region: 10-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-63
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 291-365
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000363
Family Ubiquitin-related 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014517   Gene: ENSXMAG00000014460   Transcript: ENSXMAT00000014537
Sequence length 747
Comment pep:novel scaffold:Xipmac4.4.2:JH556662.1:293537:321814:1 gene:ENSXMAG00000014460 transcript:ENSXMAT00000014537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRVPLQQPQTCGPWELKERLGTGGFGNVTRWQNKDTEEQIALKQCRQELSERNKERWSL
EIQIMKRLDHVNVVAAREVPQGMQKLVATNDLPLLAMEYCQGGDLRKYLNVLENCCGMRE
GSILILLRDISSALTYLHSKRIIHRDLKPENIVLQQGEKRLIHKIIDLGYAKELDQSSLC
TSFVGTLQYLAPELIERQKYTVSVDYWSFGTLVFECITGFRPFLPTWQPVPWHNKVRLKN
DNDIVVYENLSGDIRFSKNLPQPNNLNSLLSERLEKWLQLMLKWSPKERGKDPNNTPSDC
FHQLESILQLKLVHVLNMMSAKILIYAISDDETVANLQLRIEKDTNIPAANQELLLEAGL
VLEPNALASQSAVDYMEVDGRRTDYTLVFLFDCSSCTYEPQFSPRILPENIRFIQKDPRI
PLPYSHLRRTCGQVWHTIRSLKEDWQRLQQGQKAAIMSLLRHNSTLSKQKIEMVSMYQRL
TAKLDFFNTSLHIDMDKYNEQTATGIASEKLLSVWREMEQIALSCGQKAQVTELEEEMMK
LQPDIVDVQRQPWRSGETLDTLEGKAMELFRKLREKPRDQRIPGDGTEAARLMVQAVQFY
EKKLRDFYTVLSKTAMCRHRVMELLPKVEEVVQKLAESEQVLMGLQEKRQKELWDLLKIA
CSKVRSPVSGSPDGLRTPSSVPPLLTPRNSLQQQDESLVEESRTFEGRLQSLLHETIQES
ESSMEMLKEWTWLRGQEEESKSVSQAE
Download sequence
Identical sequences M4AJ73
ENSXMAP00000014517 ENSXMAP00000014517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]