SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014547 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014547
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-41
Family DBL homology domain (DH-domain) 0.0000605
Further Details:      
 
Domain Number 2 Region: 181-297
Classification Level Classification E-value
Superfamily PH domain-like 1.58e-37
Family Pleckstrin-homology domain (PH domain) 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014547   Gene: ENSXMAG00000014523   Transcript: ENSXMAT00000014567
Sequence length 459
Comment pep:novel scaffold:Xipmac4.4.2:JH557497.1:1270:7093:1 gene:ENSXMAG00000014523 transcript:ENSXMAT00000014567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTTEREYVRSLRYIIHHYFPEMERADLPQDLRGKRSVIFGNLEKLLDFHSQFFLRELEA
CWKHPLRAPHCFLRHQQEQFSLYALYSKNKPKSDALLMNHGQAFFRRKQLELGDKMDLSS
YLLKPVQRMSKYALLLSDLTKEVGGTQEAELTALQDATNMVKFQLRHGNDLLAMDAIREC
DVNLKEQGQLIRQDEFTVWSGRRKCQRHIFLFEDLLLFSKPKKMEGGLDVFIYKHSFKTA
DVGLTESSGDDGLRFEIWFRRRTAKNQTFVLQAASADAKHAWTADVARILWSQAARNKEM
RLKEMVSMGVGNKPFLDIQPSDAAISDRAVHYIMKPRGARTRASIAVATFDHAHPFSRAA
ASEAAASGPSSCSLLGPLNLHMFSLLTLPSSCSSTPPPADASFSSSCIEEDEQEQETSSQ
PSMTTESSGSSSRCLSGSTGSDSGCASSHLQDEPRPSSG
Download sequence
Identical sequences M4AJA3
ENSXMAP00000014547 ENSXMAP00000014547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]