SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014622 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014622
Domain Number 1 Region: 11-205
Classification Level Classification E-value
Superfamily ARM repeat 4.89e-31
Family MIF4G domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014622   Gene: ENSXMAG00000014594   Transcript: ENSXMAT00000014642
Sequence length 221
Comment pep:novel scaffold:Xipmac4.4.2:JH556894.1:108052:113097:-1 gene:ENSXMAG00000014594 transcript:ENSXMAT00000014642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENCSEDYRIQSFDVDTQKLLKTALKDPSSVNLEKVSNILVDQSLKDPLFSKEAGRICYT
IVQAEAKQDNGTVFRRHLLNRLQQEFKEREETRKRSLQGWVCYVTFICNIFDYLKVNNMP
MVALVLPVYDCLMRLAQPDALLNEEEVDCLVLQLHRIGEQLEKVNSQRMDELFFLLRDGF
LLQEGLTSMARLLLLEVLEFRAGGWMLSSTAHKYYYSEIAD
Download sequence
Identical sequences M4AJH8
XP_005808781.1.87360 ENSXMAP00000014622 ENSXMAP00000014622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]