SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014671 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014671
Domain Number 1 Region: 544-1020
Classification Level Classification E-value
Superfamily Ras GEF 8.11e-126
Family Ras GEF 0.00000000000101
Further Details:      
 
Domain Number 2 Region: 5-155
Classification Level Classification E-value
Superfamily Histone-fold 2.09e-49
Family TBP-associated factors, TAFs 0.00000122
Further Details:      
 
Domain Number 3 Region: 186-376
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.98e-38
Family DBL homology domain (DH-domain) 0.000000397
Further Details:      
 
Domain Number 4 Region: 395-551
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-35
Family Pleckstrin-homology domain (PH domain) 0.00000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014671   Gene: ENSXMAG00000014615   Transcript: ENSXMAT00000014691
Sequence length 1196
Comment pep:novel scaffold:Xipmac4.4.2:JH556695.1:359449:384384:-1 gene:ENSXMAG00000014615 transcript:ENSXMAT00000014691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVSHFQVQEQVHPTLKAKEDALQHIEELILQLLNMLCVAQPRTVQDVEERVQKTFPHPI
DKWAINDAQAAIEKRKRRSPLLLPVDKIHPLLKEVLGYKVDYHVSLYIVAVLEYISADIL
KLAGNYVGNIRHYEITQQDIKVSMCADKVLMDMFDQEEDIGVMSQFTEEPLSLSELSYDE
LVKLEIAEERQYLRELDLIIKVFRNHFLSHPKVFTDEDVEVIFSNILDIHELTVKLLGLI
EDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETLSQDILGKKFNEHFHEMMQRQTVRQH
FGSNPGGFKECVQYVLPQLMKVPVYHCLHYFELLQQLQERSKEQDDRECLKQAITALLNL
QSSVERIYVKHQPRRKPVEAIYRRYSRQVRGKQLAIKRMIEIQKSIDGWEGKDIGQCCNE
FITEGTLIRAGAKHERHNFLFDGLMISCKANQSSRLPGSGSGAEYRLKEKFVLRKIRIVD
REDSQELQHAFELIFKDENSAVFCARTAEEKANWMAALMALQYRSTLDRMLDSILQTEEQ
QRPLRLPSPEVYQFAVQDSEENIVFEDRVQSKTGIPIIKAGTVVKLIERLTYHMYADPNF
VRTFLTTYRSFCKPQELLTLLIDRINIPESGNGDDEVAIWNGDPPTTAELQRFRREYVQP
VQLRVLNVFRQWVEHHFYDFENNPDLRVQLEEYITKKLQLRGKSMRKWVESINKVIRRKL
QIQSNGVSHNITFESSPPPFEWHICKAGQIENFELMTLHPIEIARQLTLIESELYRAVRP
SELVGSVWTKEDREKNSPNLLRMIRHTTNLTLWFEKCIVEMMNHEERVAVLSRVIEILQV
FQELNNFNGVLEVVSAINSVPVYRLDHTFEAIPERKKKILEEAVELSQDHFKKYLAKLKS
INPPYPCVPFFGIYLTNILKTEEGNPDFLRRHGKDLINFSKRRKVAEITGEIQQYQNQPY
CLKVEQDIRKYFENLNPMENMSEKEFSDYLFKKSLEIEPRNARQPARFPRKTTYSLKSPG
LRPVRTSTSGTLKGHPVALERDLQHKITFRSIAENDQDPPSSASVPTSPNTPTPPPSASS
DLGPVFDHDLNSSYGSSMFPCLLNPSKLQSVSCGSLHQLGEEPKPPPLPPRRKDTVSEAK
QQSSMCDSPPAIPPRLPPLPRTQHRSPLYNGPHYDGPLPSPPSPPPPRPCPRATTP
Download sequence
Identical sequences M4AJM7
ENSXMAP00000014671 ENSXMAP00000014671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]