SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014762 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014762
Domain Number 1 Region: 199-338
Classification Level Classification E-value
Superfamily PH domain-like 6.89e-44
Family Third domain of FERM 0.000000202
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-39
Family Second domain of FERM 0.000000875
Further Details:      
 
Domain Number 3 Region: 486-573
Classification Level Classification E-value
Superfamily Moesin tail domain 4.05e-32
Family Moesin tail domain 0.0000174
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-26
Family First domain of FERM 0.00000723
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014762   Gene: ENSXMAG00000014727   Transcript: ENSXMAT00000014782
Sequence length 573
Comment pep:novel scaffold:Xipmac4.4.2:JH556819.1:80206:134249:-1 gene:ENSXMAG00000014727 transcript:ENSXMAT00000014782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPVNVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYTDSKGYVTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQKLFFLQVKEAILNDENYCPPE
TAVLLASYAVQAKYGDYSKDVHKPGYLANDRLLPQRVLEQHKLTKEQWEDRIQTWHEEHR
GMLREDAMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHEDKLSPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHHKQMERAQLENEKKKRELAEKEKERIEREKAELIERLRQIEEQTQR
AQKELEEQTRRALELEQERKRAKEEAERLDRERQAAEEAKAALAQQAADQMKTQEQLAAE
LAEFTAKIALLEEAKRKKEEEASEWQHKAISAQEDLEKTREELKTAITSPPAPEHDDEHD
ELNSEAEAELVSDGVSSQRSEEERVTEAEKNDRVKKQLQALSSELAEARDDTKKTQNDML
HAENVRAGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences M4AJW8
ENSXMAP00000014762 ENSXMAP00000014762 XP_005806291.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]