SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014791 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014791
Domain Number 1 Region: 515-752
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-58
Family DBL homology domain (DH-domain) 0.0000166
Further Details:      
 
Domain Number 2 Region: 750-876
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-37
Family Pleckstrin-homology domain (PH domain) 0.00059
Further Details:      
 
Domain Number 3 Region: 331-386
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000593
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014791   Gene: ENSXMAG00000014765   Transcript: ENSXMAT00000014811
Sequence length 1361
Comment pep:novel scaffold:Xipmac4.4.2:JH557313.1:82571:115750:-1 gene:ENSXMAG00000014765 transcript:ENSXMAT00000014811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDNVFYDPTTLFLIDTDGEEENSSSLPVNGHPRRDREVQNQFSQRTSDPLLSIVNHSDH
TQQTQACEELKIDDVTRDSTGTDGGLWDPDDLLVTDTPPPHPRCEDLLPGSVSLSPVNRA
LTSVSRRPFTEPISPPLETCDISLVALEVDSEDEGPGPKSLLSRLFSDVGRSEDKKETPP
PAPDLTCTRSQSASACEPISKDLSEDGVRLRSYSYSYSKFCPSRNPRDSHTPEGSPDGVL
HSVSHSRSLLQALSLSKSTLSLSLLHPGKQRASSISEQSNDKRIEEEELEKCNIPTKAES
EKYKVIRTFSFLKNRMSSTRNKNKGKGKDREAKDRHLNGHWFGTGPCLGPTLCVVCDKPA
SGKDLLHCSGCTAIVHKSCKESVPPCLKKLQDRCAMTVEKSKTASLPQNFTVRDSPSHSV
IPISASQPVLTPRERKDTGTQSCSLPGSLPNSDSMLSESSETESEALRLKSHSEELLPTP
GSSASNESSFGDDCVDSYIQTHGNILADSADYEAESWSLTVEHKFCKRQDKRAVKRQDVI
YELMQTELHHLQTLHIMAEVFRRGMKEEVQLDTESVERVFPCLDQLLAFHHAFFAAMKER
RQSSGQPPSHGNYLIQQIGDILLRQFSGENGEKMKQVYGEFCSHHNEAVAFFKDLMQHNK
RFQSFIKQQGHNSLVRRREIPECILLVTQRITKYPVLLERILHYTQEQTEEHGNLSKALT
HIRDAIAGVDVRVSEYERHQRLQEVWNRMENRSAAKLKSGNTFRKQDMMGQTLRHQGMLL
WKTATSRLKDVLALLLTDVLVFLQEKDQKYTFATVDQKPPVIALQKLIVREVANEEKGMF
LISASSAGPEMYEVHTSSKEERNTWMRLIREAVESCPEEPEEYASESEEEKRTAEARFQK
ILKLQESLTSQDQQICSSLEEKLQIYTELSALSERTDAALLEPRLLVQPQSEELPQAAAL
LAAALQEAENLKAALSSKARSLWSHSQDSDSVFPISPAALSELSSEPSEENGGNQSDGFD
LQPTSDSQKNHQSIVDVEAAEGVQTLTQLLYSLQAAVTIQDTWYEVQKLLLQASELASPR
GPCLHLHGLRGNSLQEQEKQRNLEKRKEEVAAAQRLREQLRQERERWERECQAKESQQVE
QESQLVERERKCLQAAQKLRQEREELEEQLEEYQQSLERLREGQRSVERERERLEDQQKL
LQAWTHGRQSSLPAVIPHMVIPLDVQQASPPNNSRQHSGNGSVFVNEAAFAGGSVNNRHF
HHKRNDPRAHNCFNSLLDRSNNRQYPGVTSPHGTGYIYTNPLGSPKHSTGEHSYNGNTWM
STADPDPELPHPSEHHLELSTLVSLETDSNQEEGRETIVFL
Download sequence
Identical sequences M4AJZ7
ENSXMAP00000014791 ENSXMAP00000014791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]