SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015019 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015019
Domain Number 1 Region: 110-218
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-28
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 2 Region: 223-362
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-24
Family Third domain of FERM 0.0026
Further Details:      
 
Domain Number 3 Region: 15-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.34e-17
Family First domain of FERM 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015019   Gene: ENSXMAG00000014965   Transcript: ENSXMAT00000015039
Sequence length 607
Comment pep:novel scaffold:Xipmac4.4.2:JH556695.1:658888:687598:1 gene:ENSXMAG00000014965 transcript:ENSXMAT00000015039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRLSFHNNKTMQDRRCVCVFLPNDDTLNIIVNVKTLCQELLVQVCDLLRLKDCHLFGLS
VIQNNEHIYMELDQKLSKYCPKEWKREASKGIDQFGPPMIIHFRAQYYVENGRLISDRVA
RYYYYWHLRKQVLLSQCIQREEAYFLLAAFALQADLGNFKRNKHFGKYFEPEAYFPQWVI
AKRGREYILRHIPNMHKDQFALTASEAHLKYIKECAQLDDVTVHYYRLYKDKKEVEASLT
LGLTLRGIQIFQNVGSVRQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLIYYTGCPL
RSRHLLQLLSNSHRLYMNLQPVLKQVRRLEENEEKKQYRESYISDALELDMEQLDKRSRA
SGSSVGSVSHHKRLSRHSTTSHGSSHTSGIETDSFRAPGQAPHRPLRTCSSSTTSHGSSH
TSGIESSGKERILDDDEIEMLVDDPKDYEELHEMALDQELCIHITEDMLTMSPDQTNGYS
GLIVKDISSSTSSSSETVVKMRGQSIESLPQTTTSRKPQSSTDRHSQSLDDIRLYQKDCQ
QWAELCQDTAHSYTFGCAQELNDGEGEQGQSEQRAGALSEPQPFPIKRTNKYFSLDLTND
EVPEFVV
Download sequence
Identical sequences M4AKM5
XP_005799275.1.87360 ENSXMAP00000015019 ENSXMAP00000015019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]