SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015056 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015056
Domain Number 1 Region: 4-204
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.24e-58
Family DBL homology domain (DH-domain) 0.0000362
Further Details:      
 
Domain Number 2 Region: 189-249
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000506
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015056   Gene: ENSXMAG00000015037   Transcript: ENSXMAT00000015076
Sequence length 252
Comment pep:novel scaffold:Xipmac4.4.2:JH556879.1:897654:923729:1 gene:ENSXMAG00000015037 transcript:ENSXMAT00000015076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLSRLDRVILEIVETEQTYVRDLKSIVEDYLGCIIDCGALPLKPEQVSSLFCNIEDIYEF
NSDLLEDLERSPDAAAIAECFVERSEAFDIYTLYCMNYPNSVAVLRDCMKNGSLVRFFQE
RQSTLNHSLPLETYLLKPVQRILKYHLLLQELSKHVDKSDPGYEVVEDAIVTMTAVAWYI
NDMKRKQEHAVRLQEIESLLLNWSGPDLSGFGDLVLEGSFKVQRVKKERAFFLFDKMLLI
AKKRLEQFVYST
Download sequence
Identical sequences M4AKR2
ENSXMAP00000015056 ENSXMAP00000015056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]