SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015155 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015155
Domain Number 1 Region: 205-345
Classification Level Classification E-value
Superfamily PH domain-like 2.4e-37
Family Third domain of FERM 0.0035
Further Details:      
 
Domain Number 2 Region: 102-207
Classification Level Classification E-value
Superfamily Second domain of FERM 8.5e-32
Family Second domain of FERM 0.0000594
Further Details:      
 
Domain Number 3 Region: 20-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-28
Family First domain of FERM 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015155   Gene: ENSXMAG00000015107   Transcript: ENSXMAT00000015175
Sequence length 591
Comment pep:novel scaffold:Xipmac4.4.2:JH556662.1:1045981:1091963:1 gene:ENSXMAG00000015107 transcript:ENSXMAT00000015175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMKMLRFRSPSIRSLDQEVLCTIRLLDDSEISCTIQKETKGQFLLDHVCNHYNLLEKDYF
GIRYVDPEKQRHWLEPNKPVVKQMKSLQPFTMCFRVKFYPHEPMKIKEELTRYLLYLQLK
RDIYHGRLLCPFAEAAYLGACIAQAELGDYDPEEHPSDYIRDFKLFPKQSLKLERKIMEI
HKNELRGQCAALAELNMLQRAHSLETYGVDPHPCKDFTGSTAFLGFTATGFVVFQGNKRI
HLLKWGDVSKLKFEGKTFYVIGVQKEKKLVLTFHTSTPAACKHLWKCGVENQAFYKCAKS
SQIKTVSSSNIFFKGSRFRYSGKVAKEVIEASSKIQRDPPEVHRAQFGQSRSFNSLSHKN
LIMNMEPLVPALPSTNEYEEAAADPGGKEADKPHCVSMETPYLPPLTPKAEDGLEEDDDG
GGALTISELAYSPCASMLPTPVEDNQGGVNQLFSSPVQSPARLLRELHADPDIQAQLEAD
RERDREFERTRLATRSRMSGVLASSLRLLSSNERVNTWVLGVARFVAVLMGVLLITVPTL
LLLLESDIDVSFLHEIRQTPEFEQFHYEYYCPLRRWILCKISMAMENLWSD
Download sequence
Identical sequences M4AL11
ENSXMAP00000015155 ENSXMAP00000015155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]