SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015199 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015199
Domain Number 1 Region: 206-415
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.17e-26
Family Ankyrin repeat 0.00087
Further Details:      
 
Domain Number 2 Region: 517-631
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000222
Family Second domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015199   Gene: ENSXMAG00000015127   Transcript: ENSXMAT00000015219
Sequence length 739
Comment pep:novel scaffold:Xipmac4.4.2:JH556670.1:2962351:2973231:1 gene:ENSXMAG00000015127 transcript:ENSXMAT00000015219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNEDGSEDVYVAVIRPKNQVSLTSKEYRAKAYEILLKEVPLEGKEKKRKKVLLVTKIKP
GDKSKSILDYVDETIKPISNSQSFIGKRVVHMKKFILEGDNEGKETSLFVVPVSVKDNSK
AIHISGSPSFYCFQDIMRVCSETSPHFCSITSKMLLALDKWLAEQHTVPHAIPALFRPAP
VERVKTNVNNPAYSSEGKLSDEGLHMGYTALEIKSKMMSLEKADMCILNPLFGSDLQYTN
RVDKVIINPYFGLGAPDYSKIQIPKRDKWQHNCVGEDKDHQWVDDFPLHRSACEGDTELL
SKLLESGFSVKQLDSDHWAPIHYACWHGKVESTKILLEKGKCNPNLLNGQLSSPLHFAAR
GGHAEIVKLLLQHPEIDRHIEDQQKRSPLQVCEENKQNEWEETIKLLQQANSKPYEKVRI
YRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLHLQLKPYHKPLQHL
RIWTEIVTDLTVLDPQRESPQLFLRRDVRLPLEIEKKVEDPLAILILFDEARHCLLKGYF
PAPDSKLITLASLLLQIIYGNYESKKHKQGFLNEENLKSIVPILKVKSKAYHWTNRILHE
YKALSTSEGLSKEMHHLQRLFLQNCWDIPTYGAAFFTGQVYTKASASNHKVIRVYVGVNT
KGLHLMNMETKVLLISLEYGTFMWQLGHADQYFQIHSGDNKMNFIVHTKQAGLIVKLLMK
LSGQMTHTDKGPTDKYAYG
Download sequence
Identical sequences M4AL55
XP_005796531.1.87360 ENSXMAP00000015199 ENSXMAP00000015199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]