SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015438 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015438
Domain Number 1 Region: 377-552
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000957
Further Details:      
 
Domain Number 2 Region: 249-358
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000417
Family PLC-like (P variant) 0.047
Further Details:      
 
Domain Number 3 Region: 51-116,172-204
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000167
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 3-41
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000746
Family DBL homology domain (DH-domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015438   Gene: ENSXMAG00000015396   Transcript: ENSXMAT00000015460
Sequence length 588
Comment pep:novel scaffold:Xipmac4.4.2:JH556784.1:551692:562812:-1 gene:ENSXMAG00000015396 transcript:ENSXMAT00000015460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWQDLLKTTPVEHKDYAALQEALRLSQSFLSGVNESSQSKREVTLTHGMRRQLMRDGFVV
DASDGVRSLRHFFLYTDLLLCTRFKHAGRGKQDQYRFSWYLPLAGLRLRWVADHEQPPDT
TVRLLNLRTKMFLLRQQLQQNPKGARGLTWTARNRKKLEQMELLLLTHSPVYRLDLHSPS
GKSHTLFFPSLYDLEEWRDNIHKLTRGKMRLCGVTTKNLLTLTCACVKLRMTQQPHLHSS
VAAEDEKSLCGTVSVAIHSASGLQEPACVYVCVEVDGYEFYDKQAQTHSSVRSLNPLWDQ
ELSFQVDGAQKMMVLCVSQSDGEEAVLGKTTVQLESSSLSSRWRRQTLQLGQLEVTLSLK
YCPHQLEAPGAPIQQPPVFCVPIEKVAQQEGVLVPHVVRCCVEEVERRGMDEVGIYRISG
TATDISSLKAVFNTNLREAVTRLRSAEVNTVSGVLKLYFRELPEPLVPPDLFQSLAKTLD
IQDMNSRLVSMLSLLQSCPDVNRNTFLYLIHHLQRVAKRQDVNKMTLMNLATVFGPSLLR
PPVAGLEHNGVTVDISQEVVIQVQVVFSYLQSNSLPEAQTSLPYGSDT
Download sequence
Identical sequences M4ALU4
ENSXMAP00000015438 ENSXMAP00000015438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]