SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015556 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015556
Domain Number 1 Region: 15-128
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.45e-28
Family Pyk2-associated protein beta ARF-GAP domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015556   Gene: ENSXMAG00000015529   Transcript: ENSXMAT00000015579
Sequence length 248
Comment pep:novel scaffold:Xipmac4.4.2:JH556784.1:744112:752543:-1 gene:ENSXMAG00000015529 transcript:ENSXMAT00000015579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNRKHRDNQEICSRKVRELAQSGVNKHCFECNQPGVTYTDITVGSFVCTSCSGMLRGLN
PPHRVKSISMTTFSQQEVEFLQNHGNEVGRRTWLCVFDPKADGCPDLKDPQKFKEFLQDK
YEKKKWHFSKSKNRRDVEGPWSPGVQAVPSSHGPLSSQGPSHNLPPNARSTRPLSQSQLP
SWDRAPTISPADMRTDAFTAKRQRPGSLSSALGGQSHGPSFPALPRPSASSSFKNHFTLD
ALSVDVSV
Download sequence
Identical sequences M4AM62
ENSXMAP00000015556 ENSXMAP00000015556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]