SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015660 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015660
Domain Number 1 Region: 66-285
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-51
Family DBL homology domain (DH-domain) 0.00041
Further Details:      
 
Domain Number 2 Region: 421-485
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-16
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 3 Region: 275-427
Classification Level Classification E-value
Superfamily PH domain-like 0.000000164
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015660   Gene: ENSXMAG00000015629   Transcript: ENSXMAT00000015683
Sequence length 509
Comment pep:novel scaffold:Xipmac4.4.2:JH556784.1:830836:838752:-1 gene:ENSXMAG00000015629 transcript:ENSXMAT00000015683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTSEPLYQTYNDFAIKKEIHRQTVIRNISKTSMDYATEFAARFSEKPSARLSPVPTVSQT
TLWQELPNVRESGLLDQLTVNQIKYQESMFEVLTSETSYLRSLYVLTEHFMENRELAGTI
IISERKTLFSNILKVREVSERFLKDLEEHIFKEIVFPDICNILHYHAQHNFSTYIDYVRN
QTYQEKTFSRLMKTNEQFATVINRLQELPQCQRLPFISFLLLPFQRITRIKMLIENILKR
TKEGTPEEQTASKALASVSKIIDQCNRDVGKMRQMEELIEISKALEFDKLRAIPIISETR
FLEKKGELQEMSKAKTFVNMRAKFSAVYLFLFNDYLLITVKKRNGKYNCSRKSITFDLSF
SMLGWEIPPSVFPSSCCRHNILPVQKSKERRRSRSDMQRWLAAFPSTTKEDVDEEVIYED
WDCPQVQCVEQYIAQQSDELGLEPTEIVNVIRKTNEGWYEGMRLSDGQTGWFPDTNVIEI
TNEHVRRRNIKERYRVSQATMMVKYGKAR
Download sequence
Identical sequences M4AMG6
ENSXMAP00000015660 ENSXMAP00000015660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]