SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015758 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015758
Domain Number 1 Region: 208-328
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-41
Family Third domain of FERM 0.000000751
Further Details:      
 
Domain Number 2 Region: 98-207
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-38
Family Second domain of FERM 0.00000194
Further Details:      
 
Domain Number 3 Region: 14-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-24
Family First domain of FERM 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015758   Gene: ENSXMAG00000015732   Transcript: ENSXMAT00000015781
Sequence length 329
Comment pep:novel scaffold:Xipmac4.4.2:AGAJ01050458.1:21:3710:-1 gene:ENSXMAG00000015732 transcript:ENSXMAT00000015781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIWELFLCFLWQINVRVTTMDAELEFAILPSTTGKQLFDQVVKTIGLRETWFFGLQYQD
SKGFSTWLKMNKRVTAQDVKKNNPLLIKFRARFYPEEVAEELIQEATQRLFFLQVKESIL
NDDIYCPPETAVLLASYAVQVKHGDYSKDYHVPGYLTKEKLLPQRVLEQHKLNKNQWEER
IQVWHQEHKGMLREDAMLEYLKIAQDLEMYGVNYFNIKNKKGSELWLGVDALGLNIYDKK
DKMTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYVPRLRINKRILALCMGNHDLY
MRRRKPDTIEVQQMKAQAREEKNKRQMER
Download sequence
Identical sequences M4AMR3
ENSXMAP00000015758 ENSXMAP00000015758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]