SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015838 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015838
Domain Number 1 Region: 539-607,642-739
Classification Level Classification E-value
Superfamily PH domain-like 8.04e-32
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 2 Region: 748-862
Classification Level Classification E-value
Superfamily PH domain-like 8.04e-18
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 1165-1290
Classification Level Classification E-value
Superfamily Second domain of FERM 9.16e-18
Family Second domain of FERM 0.0073
Further Details:      
 
Domain Number 4 Region: 1060-1137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000148
Family Ubiquitin-related 0.068
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000015838
Domain Number - Region: 40-78,647-667
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00921
Family BAR domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015838   Gene: ENSXMAG00000015779   Transcript: ENSXMAT00000015861
Sequence length 1425
Comment pep:novel scaffold:Xipmac4.4.2:JH556695.1:1856532:1894888:-1 gene:ENSXMAG00000015779 transcript:ENSXMAT00000015861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVLESSGAGPGAGAVGAASVDWQKRCVALEMQLLRFRLQAGKIRELLAEKMQELEHRV
SDADQRAEKAEKQIQVMEEKLKSTNVQTGDSENSLYKKYQDLTNQLQEKDAVIRRLEVQL
EQQMLVRAQEAKIIEEKAAKIKDWVTFKLREMELENQQLKLANVKQTEQIVLLQDKLQSL
LEKPLSSGSPATSPVLDAHLVPSSPLFPPSCPGTPPAQDDSWRGLRGAASNIKSLPTDVK
RTPELVSKGLCLGDLTAYDSQSWIRDGPSSSVTGPELPVGPESKPGGPDRDNSSDELSSK
FRSQCLHSSSSSSSSSSAYELAHRPSSPGLTMTVAPKSPLFSRSPSTNNPFPICPQLPGH
QSGTSMTLPKVRTPLTPRDSIQLVKKHYSQPQPSLDRLHHLNVHIDIMTPSSASSTLKST
GTAASPFSQLVEETDIDDGLLDGMDEAMEGTELEELCQDGVSFVGLAEELEQLDPEAVKP
PTPPLHRFPSWESRIYAVAKSGMRVSEGGALTRGLGRGSTLPQCPASGPFTQLIYKNINV
PVYTTLKGKATQISSVPLPDDDSGSEDDSSSLASLRTSILSPERKGSVPGSPRAVKRGVS
MSSISSESDYAIPPDAYSLDSDYSEPEHKVQRTSSYSCESTGPETMEKSGYLLKMGSQVK
AWKRRWFVLRNGEILYYKSPSDVIRKPQGQIELNSSCCIVRGEGAQTFQLITEKKTFYLT
ADSPNILEEWIRVLQNILKVRSSSPVTVETRAKPTVRGWLTKVKHGHSKLVWCSLVGKVF
YYFRNQEDKLPLGQLQMREASVQEVDRSCDSDEDYEAGDRGFLSSHCTLVVQPKDQSPTY
LLIGTKQEKDTWLYHLNVAAGSSATLKVGTECEQLIGKLMDVEGDPESVLWKSEALSFCK
EGLRSPLTTLPSEALQTEALKLFKSCQLFINVLVESPSVDYHTSLAQNALQVCLTHPELQ
NEMYCQLIKQTNRRTPHNYSLTQCWQLLSLCVALFLPQQHFLWYLRQYLQHNADPRTEVG
KYAVYCQRSLERTLQNGEREAKPSRMEIVSILLRNPYHHSLPFSIPVHFMNNTYQVVGFD
GSTTVDEFLSTLNQRIGMRKPQLTGFALFTDDPSGKDLEHCLQPSAKVCDVISKWEQALK
ELHPGKNEGTRIVRLTYKNRLRFRSQVKGETERERLLLVYQVNDEVQQGLFPVNKELALE
VAALIAQVEHGDFERSGVSSPAGFPQSKSQLILLQALERFYPKRYKQECTTEQLRDLTER
LASKWSMLRGCSAAECVRIYLTVARKWPLFGAKLFSGKPVPPSPVDQSQVWLAVSEDGIC
VLDGTMHTLFMYPYHSVVTFGGCREDFMVVTSQQRESGVGNKNVEKLVFAMTKPKILELT
LLMASYINHWNPTVPSASHQPLGHWDVDSRHFPAMNYTTKGPTLL
Download sequence
Identical sequences M4AMZ3
XP_005799353.1.87360 ENSXMAP00000015838 ENSXMAP00000015838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]