SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015868 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015868
Domain Number 1 Region: 104-217
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-25
Family Phosphotyrosine-binding domain (PTB) 0.038
Further Details:      
 
Domain Number 2 Region: 5-102
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000471
Family Pleckstrin-homology domain (PH domain) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015868   Gene: ENSXMAG00000015836   Transcript: ENSXMAT00000015892
Sequence length 513
Comment pep:novel scaffold:Xipmac4.4.2:JH556784.1:1305673:1321424:-1 gene:ENSXMAG00000015836 transcript:ENSXMAT00000015892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTESVVVEGYARLREGKKWRTRWLVFRKPSPVADCLVLVVFKDKSDKLQSNRERASFTLE
EICGLEPGQWYEGAAFTLAILCLNQVALLGFDSREALQAWELRLRYGLGEVHRFSVGVLP
GTKLEGGPATLHLCNNLLALVRDFPPVIIGHWNLPDLRRYGPVPNGFVFEGGTRCGYWAG
VFLLAAAEGEQISFLFDCIVRGICPSRGPFGLRPVLPELNSGQTNSEEKLNLETQELEKR
LSMLSSESSTVSSTYFPCAGGDDRSISGSSDTSDTSQSDCSISSRLAIWTEPASNATGSV
CHAGAKVPLQTVEKLSAGQGGVGRPSAKPPRQLQDIGRQSSSDSGIATGSQSSYSGSFSS
YTGSLDIAPGEDFGSVFSLPPQLALELSPCSCPTAPGQEYQVPTSLLGYLYDSPRRVLHE
ASGGDKDCEPFKSTEDHPVPSDCPTESDLGGAGGATTEATDGQSDPAHAQGPSSDGRKTK
ALPSSGSSLTCSSLSASKTVVAICSVCGGFKVR
Download sequence
Identical sequences M4AN23
ENSXMAP00000015868 ENSXMAP00000015868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]