SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016496 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016496
Domain Number 1 Region: 200-352
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-31
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 90-199
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-23
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 5-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.01e-18
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016496   Gene: ENSXMAG00000016435   Transcript: ENSXMAT00000016520
Sequence length 935
Comment pep:novel scaffold:Xipmac4.4.2:JH556727.1:815717:827155:-1 gene:ENSXMAG00000016435 transcript:ENSXMAT00000016520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMTDGKLCQVQLLDDRKLELLVQPKLLSYELLDLVSSHFNLKEKEFFGLAFFDDNGQCKW
LQMDRRVLEHDFSKKPGAISLNFLVRFYLENITQLKDIITVELFYLNAKSAIYNGMIEVE
TENVFRLAANALQEAKGDYTSDENTRADLKKLPTLPTKVLKEHPSLAFCEDRVIEYYKQL
KGVSRGQAIVQYLTLVESLPTYGVHYYEVKDKQGIPWWLGISYKGIGQYDLQDKLKPRKL
YQWKQLENLYFREKKFAVEVNDPHRRTVTKRTFGQTGLLIHTWYASHSLIKTIWVMAISQ
HQFYLDRKQSKAKLGPARTLEEIAMEITEHGGAKMNRLGDVGLKNNCITASNGSLGSTGS
ADSEMSEEQKKEKLSELRKKEQEIQDILAKKTKELKKICLREAELTGKLPKEYPLSSGER
PPQVRRRVGTAFKLDDLFPYNEDPFLRNLESRFALQRKIVEAAKKLANESELCKTVKKKR
RRNCLDAMHKLQQIEDEMNQYRIKKGKKPTQRASVIIADELTRSNCSSLSSLPLDDDDSD
GASQRPRSRSVQGSPQLSPLRSLGAEYGSFTSSCFNKCLLVHVENQREVSSTNSSPYKTL
PRPPRDPRSMPPTPVMTRNAYSSSQLRSEGSPHCFRHRSGSLESQPRLRKDTDAEKPVFI
LSPSHRSNSTEVLEDCSSYTSQSSLDYCGAANSHYGTLDSRASTMHRLHRKVEVYGNTGS
MPNLVQHHSSCNYQCETSSHYAPSAYYVASYTCQDMEPYANGAYVYENEVEGHYNVNPSY
QMNGYHGHDRFRHYSSDRADSLSQNPYATVRPPRSREGPRNELLAKNMQKALVAEHLRGW
YHRSKGHREGGRGLMVGYDFDSGSQLSLGYQTMPAAFSHSSRTTSFSSVSSVESTGNWRN
QLAVGLTEFDTPDVSQYSPAGAQASLYNRSPTHRR
Download sequence
Identical sequences M4APV1
ENSXMAP00000016496 ENSXMAP00000016496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]