SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016721 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016721
Domain Number 1 Region: 715-931
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-54
Family DBL homology domain (DH-domain) 0.00036
Further Details:      
 
Domain Number 2 Region: 920-1041
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-23
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 1094-1268
Classification Level Classification E-value
Superfamily PH domain-like 6.52e-22
Family Pleckstrin-homology domain (PH domain) 0.0000916
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016721   Gene: ENSXMAG00000016684   Transcript: ENSXMAT00000016745
Sequence length 1270
Comment pep:novel scaffold:Xipmac4.4.2:JH556669.1:2840995:2862339:-1 gene:ENSXMAG00000016684 transcript:ENSXMAT00000016745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKPPVAPKPKFIPKQRPVLSSPVPKRDGLSPLYPGPPKKVKPALPPKPCLAKLLSPSES
KPLIWKRMQQEPALETHQRVTTLNSHNGISHSKKPDWDYIIPICLCSQENCACVKNKKLE
QGEKDFESSHVVGKPEENQKTVPIPQGSQDNNRGKTNNTKSQVMNNSSSNDHIINHYEAN
RTQNHNFDSYSLSTDNGVGPSPRSSSEGIESSAIHPDVRGPGQQAGSLGTEQTSALQPKR
APPVLRKPGFPVPRKPRRYVPAHQEKVENDRDETAVQEKWEASVKEVEVSTDGKGCSSLS
VSEPGNENRPPVFLSARRACPPPVPPFRKKPLLSNHLNTPSPSMQTPSKDMRVEDSSRGS
SIYEIELCVDGEVDKMQKKVMDDQVESNHLLFHTLLKQPELKDLPTTILAAEDKRMENKM
PRKHRRNKSSLGLIQKKEILEGEGVNKLEDFEARQASTAPDGVSKDLMRRELPLTPDEKL
SKKHAAAGNNKPSRSSTAKKKAKSFSTADCSRSEGQRGNTFKKMLELKLVKKTPPKTPAK
PDRTNESTANNFIPESHRDPYVQQKFPVFVGTDNNFHHSQTDVEQSVDGDELYPEPKVSP
IYETIPLYDDIPQYENVNVGKARSPPGFNTEGWPRSPYDDEGIYELQDPYFSLVINSEHH
QTPTEYHRNSVDEEAAFISDSLSDDDIAVNTSDEDDEDDSSVNSDKDDTEHPAPCTVQSG
QKKSKIQHIATEIMTSESVFVDVLKLLHVDFREAVHKASRQNGKPVIEERHLNQILYYLP
QLYELNQDLLKELEQRVANWDESSQVADIFLKKGPYLKMYSTYIREFDKNVALLVEQSKK
NSAFGAVVKEFETSPRCANLAVKHYLLKPVQRIPQYQLLLTEYLKNLSVDSDDYKDTEAA
LSLVKEVANHANDIMKHGDNFQKLVQVQCRLNGNHEIVQPGRSFIKEGVLMKLSRKVMQP
RMFFLLSDVLLYTTPVQSGQYKLKNMLSLAGMKVSKPSQEAYQNELNIESVERSFILSAS
SAAERDEWLKTISSAISEYTKKKISFISNNKPAEENLGESVDGPPLGSTAPIWIPDTRTT
MCMICTCDFTLTWRRHHCRACGKVVCQACSSNKHGLAYLKKQSARVCDQCFDILQHKSEI
ASAATLSPGSKATVAFNRKHKRIPAALKEVSANTDNSSMSGYLQRTKHNKKQGKRLWFVI
KDKVLYTYAASEDVAALESLPLLGFVLEVDSSQKQQFKLVHKNILHYIFRADDVQTAQRW
IDTFKEAVVL
Download sequence
Identical sequences M4AQH6
ENSXMAP00000016721 XP_014329345.1.87360 ENSXMAP00000016721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]