SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016746 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016746
Domain Number 1 Region: 619-685,899-1239
Classification Level Classification E-value
Superfamily Ras GEF 1.06e-119
Family Ras GEF 0.000013
Further Details:      
 
Domain Number 2 Region: 221-443
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.29e-43
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 3 Region: 23-130
Classification Level Classification E-value
Superfamily PH domain-like 1.65e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 431-586
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000668
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016746   Gene: ENSXMAG00000016680   Transcript: ENSXMAT00000016770
Sequence length 1242
Comment pep:novel scaffold:Xipmac4.4.2:JH556662.1:4967238:5029036:-1 gene:ENSXMAG00000016680 transcript:ENSXMAT00000016770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALFLSVVARKEGTKRGYLSKKTAENSRWSEKFFALYQNVLFYFENEQSA
RPAGIYLLEGCTCERTPAPKISTTGKEALEKQHYFLIVFGHDGQKPLELRTDEECECDEW
VEAIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKSEIVA
LNKTKERMRPYHVYHENEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKR
NQIVFNMVEAETEYVHQLYILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHE
IFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLK
QYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSR
VMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGS
LSLKKEGERQCFLFTKHFLVCTRSSGGKLHLLKQGGVLSLIDCTLIEEPDATDDESKTAG
QVFGQLDFKLVVEPSDSPSFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENS
KVTVPHMIKSDVRLHKDDIDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNT
FLHTYRIFTTASVVMDKLADIYKKPFSSIPIRSLELFFATNQNNRGTDNTNDRSPRLCRK
FSSPPPLSIQSRTSSPVRIRKLSLHSPITARVGGLDLTTPQTPTPQTPTPTATSPPSSST
SPPPNNCKPSQDPLTPSSPDQSPIPAADGEEAPRIDPFCGKLRRSIRRTVLESVSLEKII
PESPQNSEAGDMSPCRSPSTPRHLRYRQPGVQSGENSRCSVSPASAFAIATAAAGHGTPP
VFTNSERTCDKEFIIRRAATNRVLNVLRHWVSKHSQDFEMNGELKMSVIYLLEEVLRDPD
LLPQERKATANILNALSQDEQEDAQLRIEDILQMADCPKAEYFESLSAMELAEQITLLDH
IVFRSIPYEEFLGQGWMKVDKTERTPYIMKTSQHFNDMSNLVASQIMSHTDVGSRASSIE
KWVAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGR
FKNLRETLKNCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQF
QQTPYRIEHQPKVTQYLMDKTLTMDEDTLYDLSLKLEPRLPA
Download sequence
Identical sequences M4AQK1
ENSXMAP00000016746 ENSXMAP00000016746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]