SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016931 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016931
Domain Number 1 Region: 72-124
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.64e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 
Domain Number 2 Region: 228-309
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000496
Family Ras-binding domain, RBD 0.028
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000016931
Domain Number - Region: 320-347
Classification Level Classification E-value
Superfamily Ferritin-like 0.0365
Family half-ferritin 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016931   Gene: ENSXMAG00000016883   Transcript: ENSXMAT00000016955
Sequence length 363
Comment pep:novel scaffold:Xipmac4.4.2:JH556674.1:1316359:1326544:-1 gene:ENSXMAG00000016883 transcript:ENSXMAT00000016955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGSSPLTATMSWGEFIELRDLNSGREQIGLAGPRLPCSPPRLERTNALRISPGKVPDLLS
RDPQFVEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHYRCRALIRL
DCSWERGSTADLTAVVEHTIETDTNVDEQIQCEKQELSTAEILQKVKEYNSQINSNLFMN
MNKDGSYTGFVKVQFKLVRPVSVPAPKKGGPDAGGKRASGVKRRTSFYLPKDASKHLHIS
SRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYVRKLSDDERPLRLRLNAGPNEK
LLSFVLKENETGEVNWHAFSMPELKNFLLILQREEEEHVKQIVQRYTLARTKMLEALSGS
TPG
Download sequence
Identical sequences M4AR36
ENSXMAP00000016931 ENSXMAP00000016931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]