SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016955 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016955
Domain Number 1 Region: 162-372
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-52
Family DBL homology domain (DH-domain) 0.0000797
Further Details:      
 
Domain Number 2 Region: 389-509
Classification Level Classification E-value
Superfamily PH domain-like 7.9e-17
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016955   Gene: ENSXMAG00000016906   Transcript: ENSXMAT00000016979
Sequence length 566
Comment pep:novel scaffold:Xipmac4.4.2:JH556669.1:3139283:3148071:-1 gene:ENSXMAG00000016906 transcript:ENSXMAT00000016979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENEEVHGRTVGNQKQKLRRISSRTSTTSVISAAEPSPPQRLRRKNSKLSLQRGSSFTF
LTPGTPWDFSLKRKRKDKEDDTVSLSSFDLKEPSNKRVRTLAKVSSLVNLISPSKNGAVR
RFGQSIQSMSLRNDGKSPGTTLKAPSKAPAMTPTKRRNSTLWSETLDVHQKSAFSAKEIK
RQEAIYELFRGEQDLIEDLQLARKAYHDPMLKLSIMTQEELAHIFGDLDAYIPLHEYLTM
KLTEGTGPDGTVDQIGQIVIDWLPGLNAYKNYCSNQLAAKALLDQKKQDKRVQDFLQRCL
ESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPPNHPDVTSLERAVTIIQDILSDIN
VTKGESECQYYIDKLEFLDEKQWDPLIHDCKTLLCHGELRTKSGSRLHVFLFSELLVLTR
PVTRNDRSCFQVYRQPIPVRDLVLEDLQDGEVRLGGSFRGAFTNGEKAKNAFRVSSMDPS
HGQSHTLHVSDVYHKQQWLNCLRTAITQQQGAPARVQPVLPSPACDEKTDENCPPPPGPK
LRRQTLSKNRLEQKLQGSQRRKETGV
Download sequence
Identical sequences M4AR60
ENSXMAP00000016955 ENSXMAP00000016955 XP_005796451.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]