SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016967 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016967
Domain Number 1 Region: 405-513
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-27
Family SH2 domain 0.0000259
Further Details:      
 
Domain Number 2 Region: 80-177
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.41e-25
Family Ras-binding domain, RBD 0.00032
Further Details:      
 
Domain Number 3 Region: 213-324
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000063
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016967   Gene: ENSXMAG00000016919   Transcript: ENSXMAT00000016991
Sequence length 517
Comment pep:novel scaffold:Xipmac4.4.2:JH556661.1:4712856:4728850:-1 gene:ENSXMAG00000016919 transcript:ENSXMAT00000016991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSFEGSRMKDSSDEEDVSLGCSTLTLSPLVPESPPLRRSQPILISTNRKKGGEVLSSSES
PIPNPFPELCNLSLPNGSLPSESSDKFVIKVYGDESAYKTILIGRQATAREVCQLLVQSA
HCSNEDNWALLEIYPTLGLERCLEDHEIVLEVQATWSDKVEARFMFSKNYDKYEFFHIHE
SRFFANGMISDSEDAMKKMTSTVFIRELTSNVKSPQIKGFFYLKGYFKTSWKKMFFTLRR
SGLYISTKQTVRGDQHLKEFANLNVSNVYKVVDGCKRYGAPTEFNFCIKPTKSQGQVKDL
KIMCAETEEMRKMWICAFRLFKCGRQIKLNYNAVSESKLAPRTPVSPKLTSESENSLVAM
DFTGKAGGRIIENPTEAQNAEQEEAQAWRKRETLRFCQPNTNSEPQDFSFHETHPWFYGG
LTRNEAEKLIEKQGLVDGMFLMRRSQQHENCFVLSLCHELKVKHFIVIPVLEDGKKYLTL
DDGKTRFIDLLQLVEFYQINKGALPVCLTRPCICVPL
Download sequence
Identical sequences M4AR72
ENSXMAP00000016967 ENSXMAP00000016967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]