SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017085 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017085
Domain Number 1 Region: 619-687,919-1257
Classification Level Classification E-value
Superfamily Ras GEF 9.42e-120
Family Ras GEF 0.0000133
Further Details:      
 
Domain Number 2 Region: 222-444
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 22-129
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-20
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 
Domain Number 4 Region: 432-588
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000267
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017085   Gene: ENSXMAG00000017009   Transcript: ENSXMAT00000017109
Sequence length 1259
Comment pep:novel scaffold:Xipmac4.4.2:JH556668.1:2484655:2551880:1 gene:ENSXMAG00000017009 transcript:ENSXMAT00000017109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGMRLNDGHITYLALLAKKDGTRRGFLSKKSSDNTKWHSKWFALLQNMMFYFESESSS
RPSGLYLLEGCVCDRAPSPKPSQSAKECLEKQFYFTVTFSHENQKPLELRTEDVKDCDEW
VAAITQASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEISG
ILRDNEKIQSNPEVPPSEDDTEIKKIKKVQSFLRGWICRRKWKTIIQDYIRSPHAESMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KQYESKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIVEGCEVLLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHITKNGVVSLIDSTLMEEPEGTDDESKGER
SGQDAEHLDFKVMVEPKEGQPYTVILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFEE
NSKVTVPQMIKSDTSLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLIDLRFLSIDFL
NTFLHSYRVFTSADIVLDKLITIYKKPISAIPARSLELFFASSQNNKLLYGEPPTSPRAS
RKFSSPPPLSITKNSSPNRRRKLSLNIPIITGGKALDLAALSCSPNGYASMHTTMSPFSK
TTLDINKLYVSSTMASKIPDEGESKSEGKAEESAPGKQDRSVREECDEEQSQSDEAESEM
SPPKSPSTPKNVKSKNSDLEFSLFSFNNGMVVSSCRELENNRSALSAASAFAIATAGANE
GTPTKEKYRRMSLASTGFPTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFELNTEL
KMRVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDSQASIEEITQMAMEESKTEPF
ENHSALEIAEQLTMLDHLVFKVIPYEEFFGQGWMKNDKNERTPYIMKTTKHFNDISNRIA
SEILHWDDVNMRVAVIEKWVAVADICRCLHNYNAVLEITSSLNRSSIFRLKRTWLKVSKQ
TKTVIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVN
FSKMRMISHIIREIRQFQQTAYKIDFQPKVAKYLLDNSTVMDEESLYEASLRIEPKTSS
Download sequence
Identical sequences M4ARJ0
ENSXMAP00000017085 ENSXMAP00000017085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]