SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017374 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017374
Domain Number 1 Region: 491-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.62e-71
Family A middle domain of Talin 1 0.000000355
Further Details:      
 
Domain Number 2 Region: 755-891
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.53e-51
Family I/LWEQ domain 0.00000214
Further Details:      
 
Domain Number 3 Region: 2296-2487
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.08e-50
Family I/LWEQ domain 0.00013
Further Details:      
 
Domain Number 4 Region: 661-785
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.54e-50
Family I/LWEQ domain 0.00000485
Further Details:      
 
Domain Number 5 Region: 1840-1974
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.46e-45
Family VBS domain 0.00000922
Further Details:      
 
Domain Number 6 Region: 1227-1363
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.73e-41
Family VBS domain 0.017
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-31
Family Second domain of FERM 0.0000013
Further Details:      
 
Domain Number 8 Region: 1076-1209
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.08e-25
Family VBS domain 0.012
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 7.79e-24
Family Third domain of FERM 0.0000182
Further Details:      
 
Domain Number 10 Region: 1471-1557
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000235
Family I/LWEQ domain 0.0099
Further Details:      
 
Domain Number 11 Region: 1696-1815
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000000753
Family VBS domain 0.038
Further Details:      
 
Domain Number 12 Region: 2006-2133
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000957
Family VBS domain 0.028
Further Details:      
 
Domain Number 13 Region: 1585-1661
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000439
Family VBS domain 0.021
Further Details:      
 
Domain Number 14 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000765
Family Ubiquitin-related 0.066
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000017374
Domain Number - Region: 923-985
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00255
Family I/LWEQ domain 0.0072
Further Details:      
 
Domain Number - Region: 2108-2229
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0275
Family I/LWEQ domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017374   Gene: ENSXMAG00000017242   Transcript: ENSXMAT00000017398
Sequence length 2542
Comment pep:novel scaffold:Xipmac4.4.2:JH556668.1:2873323:2952971:-1 gene:ENSXMAG00000017242 transcript:ENSXMAT00000017398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVLSLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGAVKTIMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETVEEKKEDGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEF
GGIQAQIQFGPHIEHKHKPGFLDLKEFLPKEYIKQRGAEKKIFQEHKNCGEMTEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRVGQVNQSSVALPGVIRFGSIGTESPSMGTMPSPQQQITM
GQMHRGHMPPLSSAQQALMGTINTSMQAVQKAQIDLGEVDDLPPLGQDMASKVWIQNKMD
ESKHEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MEDDVGGGNDLMKAARTLAGAVSDLLKAVEPTSGETRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDILMNLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVESCVQACLSATEDGELLKQVSAAASVVSQA
LADLLQHVRQYTARGEPIGRYDQATDTIMTVTESIFTSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEVEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKLINRLENAAKQAAAAATQTIAAAQNAAASNKNTAAHQQLVQSCKA
VADHIPQLVQGVRGSQAKPEDLSAQLALIIASQNFLQPGSKMVTSAKSSVPTVTDQAAAM
QLGQCAKNLATCLAELRTSAQKAHEACGPMEIDSALTAVQTLRSELQDAKLAAANTQLKP
LPGESLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGIAARETAQALKILAQAARGV
AASTMDPKAAAAMLDSARDVMEGSALLIHEAKQALMSDGDAESQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDMALKSIGEASKKLLIETIPPASKSFQEAQNDLTQTAADLNHSAGEVVH
ASRSSSNQLASASGKFSQDFDEFLDAGIEMAGHTQKKDDQVQVIGNLKNISMASSKLLLA
AKSLSVDPAAANVKNLLAAAARAVTDSINQLITLCTQQAPGQKECDNALRELEAVRGMLD
NPSEPVSDLSYFDCIESVMENSKVLGESMAGISQNCKTGDVPAFGDCVGSASKALCGLTE
AAAQASYLVGVSDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPQSSPSQVLSAATIV
AKHTSALCNACRLASSKTTNPVAKRHFVQSAKEVANTTANLVKTIKALDGDFSEENRNRC
RVATAPLIEAVENLTTFASNPEFASVPAKISTEGSAAQVPILHSARSMLDSSTHLLKTAR
SLVINPKDPPTWSVLAGHSRTVSDSIKGLITAIRDKAPGQRECDSSIDNINKCIRDIEQA
SLAAVSQNLPSRDDISLEALQEQLTSAVQEIGYLIDPVSTAARGEASQLGHKVTQLAGYF
EPLIKASVGVASKLSDHQQQMTFLDQTKTLAESALQMLYAAKEGGGNPKAAHTHDAIAEA
AQLMKEAVDDMMVTLNEAASEVGMVGGMVESIAEAMAKLDEGTPAEPEGSFVDYQTNMVK
HSKAIAVTAQEMMTKSVTSPDELGALASQVTVDYSQLAVQGRLAAHTAEPEEIGFQIKSR
VQELGHGCIFLVQKAGALQISPSDSFTKRELIDCARAVTEKVSLVLSALQAGNKGTQACI
TAASAVSGIIADLDTTIMFASAGTLNAENDESFADHRENILKTAKALVEDTKMLVSGAAS
GQDKLAQAAQSSAKTITQLTDVVKLGAASIGSDDPETQVVLINAVKDVAKALAELISATK
CAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQEMAL
FQSRDAPNKTTTPEEFIRMTKGITIATAKAVAAGNSARQEDVIHTANLSRKAISDMLTTC
KEAAYHPEVNEEVKNRALMFGAECTTGYIDLLEQVLLVMQKPSAEQKQHLAACSKRVAGA
VTELIQTAEAMKGSEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
NFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAVDDGQWSQGLISAARM
VAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQIA
GNAVKKASDNLVRAAQKAAFDKADEDNVVVKTKFVGGIAQIIAAQEEMLRKERELEDARK
KLAQIRQQQYKFLPSELREDAN
Download sequence
Identical sequences M4ASC9
ENSXMAP00000017374 XP_005796221.1.87360 ENSXMAP00000017374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]