SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017421 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017421
Domain Number 1 Region: 136-275
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 9.03e-17
Family CRAL/TRIO domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017421   Gene: ENSXMAG00000017385   Transcript: ENSXMAT00000017446
Sequence length 283
Comment pep:novel scaffold:Xipmac4.4.2:JH556662.1:6202631:6207392:1 gene:ENSXMAG00000017385 transcript:ENSXMAT00000017446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDPSSSADTSAGSNHRRKLSAPPINPSLERSEGSLHSEDALDTDDDALDTGDDLDASIDG
IDTPDEADSLKMNVQGKIQAQTQCKYGATKNVTSGAASGDAAAERRGEEKGDDRLWRSVV
IGEQEHRIDMKCIQPYKKVISHGGYYAEKNAIIVFAACFLPDSDCENYNYVMENLFLYVI
STLELMVAEDYMIVYLNGATPRRRMPGFTWMKRCYQMIDRRLKKNLKMFIIVHPSWFIRT
LLGLTRPFISSKFSSKIKYVHSLQELGEIIPMEYVHIPPSIIK
Download sequence
Identical sequences M4ASH6
ENSXMAP00000017421 ENSXMAP00000017421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]