SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017484 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017484
Domain Number 1 Region: 199-342
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-43
Family Third domain of FERM 0.000000407
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-38
Family Second domain of FERM 0.00000143
Further Details:      
 
Domain Number 3 Region: 496-582
Classification Level Classification E-value
Superfamily Moesin tail domain 9.55e-32
Family Moesin tail domain 0.0000229
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.72e-25
Family First domain of FERM 0.0000126
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000017484
Domain Number - Region: 470-477
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0942
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017484   Gene: ENSXMAG00000017437   Transcript: ENSXMAT00000017509
Sequence length 582
Comment pep:novel scaffold:Xipmac4.4.2:JH556749.1:1301625:1334631:-1 gene:ENSXMAG00000017437 transcript:ENSXMAT00000017509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKAVNVRVTTMDAELEFAIQPSTTGKQLFDQVLKTIGVREVWFFGLQYVDTKGYPNWLK
LDKKVSSQDVKKDNPLQFKFRAKFFPEDVSEELIQEVTQKLFFLQVKEGILGDEIYCPPE
TAVLLASYAVQAKFGDYDKEVHRPGYLVNERMLPQRVMEQHKLSKEQWEERIQVWHEEHS
GMLREDAMLEYLKISQDLEMYGVNYFDIKNKKGTELRLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFIIKPIDKKSPDFVFYAPRLRINKSILHLCMGNHDLYMRRRKPDTI
EVQQMKAQAMEEKQMKQKERAHLENEKKKREAIEREKEQMEREKQELMMRLYQFEEKTKK
AEKDLQDQLQRAMMLEQERRRAEEEAARLEAERQAALLAKEELARQAESQLKTQEQLASE
LAEHSAKIALLEEARRRKEEEARTWQNRAVEAQDDLIKTKEELHMVLTVPPPPPPPPGYN
HRDDNSDSEDNNSTNSTDLAIDDFNDHRKEEERLTEVEKNERVQKQLKTLTSELAQARDE
SKNTQNDLLHSENVRAGRDKYKTLRQIRQGNTKQRIDEFEAL
Download sequence
Identical sequences M4ASN9
ENSXMAP00000017484 ENSXMAP00000017484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]