SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017597 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017597
Domain Number 1 Region: 201-417
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.03e-56
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 401-535
Classification Level Classification E-value
Superfamily PH domain-like 1.36e-32
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 651-749
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-19
Family Pleckstrin-homology domain (PH domain) 0.00052
Further Details:      
 
Domain Number 4 Region: 512-621
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.97e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017597   Gene: ENSXMAG00000017525   Transcript: ENSXMAT00000017623
Sequence length 752
Comment pep:novel scaffold:Xipmac4.4.2:JH556804.1:661935:681481:-1 gene:ENSXMAG00000017525 transcript:ENSXMAT00000017623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPPKPAHLLALGQDKKPKRIPPPPSRPLPAPPPPPKPKPCLSPTGQGAQPQKEPQKVGQL
IERFNNSSVILKSVGKPAPVSGFLLTEASVYPPILPSFLSLGKKSRCILGYCKRPTQNGK
IPNRDSGIDSPSCATEGEAFPNEDAIDEEDHYDSVTETESMSCCVTLDNKRDSTQDEDSD
LDEGSSGEIPSLTDTQTGYLTDTHADTQKCSEAQKLLNIAKELLHTEEAYVKRLNLLDQQ
VFCTKLTEASIPQDVITGIFSNISSIYLFHDKFLLPELKTRITGEWESNPRIGDILQKLA
PFMKMYGEYVKNFDRSMDLVNTWTQRSSQFKSVVQNIQKQEVCGNLTLQHHMLEPVQRIP
RYELLLKDYLKKLPDEALDRKDAEKALELISTAANHSNAAIRKMEKMNKLLEVYERLGGE
EDIVNPANELIKEGHIKKMSAKNGTAQDRYLYLFNNMVLYCVPKLRLMGQKFSVRERIDI
AGMEVQENVKQNLPHTFVIIGKQRSLELQARTAEEKEDWIQVIKATIERHKQNSETFNKA
FSSSFSREDDHVPESPSDGLHERKISRKKDKEKQTCRGCHESFNFTKRKHHCKSCGVPIC
AKCSKTLDNKTSRVCPECFEASLSVEMMCGGEQKRKAAPERQLSLTGDSCLLCGYLQVQE
KGKSWTKMWVALTKPEPLVLYLQSSGQDLKGSRAVPLPGFEVSTVLSATADKPEVKHVFK
LSHSQQIFLLSAQDAELQAKWVEVLSKASRGE
Download sequence
Identical sequences M4AT02
ENSXMAP00000017597 ENSXMAP00000017597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]