SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017827 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017827
Domain Number 1 Region: 1136-1358
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-62
Family DBL homology domain (DH-domain) 0.0000000661
Further Details:      
 
Domain Number 2 Region: 1357-1497
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-27
Family Pleckstrin-homology domain (PH domain) 0.00000202
Further Details:      
 
Domain Number 3 Region: 237-334
Classification Level Classification E-value
Superfamily EF-hand 1.61e-25
Family Eps15 homology domain (EH domain) 0.0029
Further Details:      
 
Domain Number 4 Region: 1071-1138
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-24
Family SH3-domain 0.0000577
Further Details:      
 
Domain Number 5 Region: 10-106
Classification Level Classification E-value
Superfamily EF-hand 7.12e-24
Family Eps15 homology domain (EH domain) 0.0019
Further Details:      
 
Domain Number 6 Region: 1510-1631
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.47e-23
Family PLC-like (P variant) 0.0067
Further Details:      
 
Domain Number 7 Region: 833-898
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-19
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 8 Region: 724-793
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-19
Family SH3-domain 0.00025
Further Details:      
 
Domain Number 9 Region: 918-983
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-18
Family SH3-domain 0.00016
Further Details:      
 
Domain Number 10 Region: 995-1065
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000131
Family SH3-domain 0.0000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017827   Gene: ENSXMAG00000017740   Transcript: ENSXMAT00000017853
Sequence length 1636
Comment pep:novel scaffold:Xipmac4.4.2:JH556668.1:4572385:4609383:1 gene:ENSXMAG00000017740 transcript:ENSXMAT00000017853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIKLYVTAGGSAVWAISQEERDKHDQKFDTLSPSMGFISGEQARKFFLQSGLPPSVLAEI
WALADLNRDGKMDRLEFSIAMKLIKLKLQGTQLPSTLPIIMKQPPVSAPASAMPNPAYGL
GSVPMMGGSNFAMLTPLSMASPGLSPLTPMTGLSPMVPTSAGMNPLIASTATRPLMPTVG
NTGLPNGTMGMLQPMLAGGLNTGLPLGTSYASPGGLSSSLLDLGFGSSASSPMAAVPSDW
AVPHPSRLKYRQHFNILDTQMVGYLTGQQVRNAMATTMLTQTQLASIWTLSDVNKDGKLN
VEEFVLAMHLVDMAKSGQPLPLTLPTELVPPSQRSAMNGSSSNLYSAMIDDLDAEPPQKP
KTNMSFEDKFKANIEQGNAELEKRRLALLEAERREQERRAQKEREERERKEREAREAEER
RRKEEEQRLERQRELERQRELERQRELERQSAAQRELERQRKEEFERRKRGELKMKKEQE
QDEIIKLKAKKRNLEVELEAVGNKQRQISDRLRDIQNNKKLQRSEFDLLDQKKDTRQQDL
KTLQRQIEDFQRKLSQLTPEKKRLAEKLQNMSLNNPTASTMSNLKMGVTEKRGSCMKLRD
QLDALEKETAAKLAQMDQYNKDMQELKESQRKQQAALEKLRSAKEEKQRELIRRKEQEEE
RKRQEEETQRRIKLEKERQWQEKLRRDEEERQRRLEEERETKKREEEERERQALLQAARK
SAALTSYKALYPFTARNNEELSFEADEVIEVDETMEKEEGWLYGSKQGKMGYFPESYVEK
VGPSDSAKLAAAAPQVSIQAQLSNALEAAKGPGTKSAFTPTQSPHPAPSETHGQPVVGNV
LAQALCSWTAKTDNHLNFNKDDVIHVLEKQENWWLGELNGEKGWFPKTYVTVLGEEDGSE
QSNSVFSVLSMPPHTVFRPKSSTSVFVIAEYVALYTYESPEPDDLTFSEGDVILVSQREG
EWWRGSTGEHTGAFPSNYVKPKEADRRNCAKTSSVSGKKKQEVAQVTKAYSSSSPEQLSL
ESGQLILIFSKNPSGWWLGELQARGKKRQKGWFPSAHVKILGSNSGKSTPAQQPVCQVIA
VYDYTAANQDEMSFSKGQLINVLDKSNPDWWRGEVNGVTGLFPFNYVQMTTDNEPSQKWC
SDPTSLDSLSPQEKKRQGYIHELIEAEERYVEDLQVVLDVFYKPMSESRRLNDAEMAMIF
VNWRELLACNSKLVKALLGRKKTTGDNMPVQRIGDILASELSHMQPYISFCSSQFNGAAL
LQTRTDNEPEFKAFLKKIATDYRCKGMPLSSFLLKPMQRITRYPLHIKNILECTAEGHPD
RGQLKEALEKAEELCQQVNEGVREKENSDRLEWIQNHVQCDGAMEHLVFNSLTNCLGPRK
LLHSGKMYKAKSSKELWAFLFNDFLLLTHAAKQFTSSGPDKLFSKRNNVQLKMYKPPVLL
NEVLVKLPDPSSDEPIFHISHIDKVYMLRTDNINERTSWVQKIKVASEEFIDTEKRKREK
VYQARSIKGTGIGRLLVTILEATELKAAKPNGKSNPYCEVTMGAQTFTSRTINDTLNPKW
SFNCQFHIRDLYQDVLCITISERDQFSPDGFLGRTEVPVATIKKELENKGPVTRRLLLHE
VPTGEVWVRLDLQLFK
Download sequence
Identical sequences M4ATN2
ENSXMAP00000017827 ENSXMAP00000017827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]