SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017886 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017886
Domain Number 1 Region: 221-338
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-17
Family Third domain of FERM 0.004
Further Details:      
 
Domain Number 2 Region: 96-214
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000051
Family Second domain of FERM 0.0044
Further Details:      
 
Domain Number 3 Region: 6-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000159
Family First domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017886   Gene: ENSXMAG00000017851   Transcript: ENSXMAT00000017912
Sequence length 442
Comment pep:novel scaffold:Xipmac4.4.2:JH557818.1:28963:33200:1 gene:ENSXMAG00000017851 transcript:ENSXMAT00000017912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTKQMRHVSVLLPNKQHLDCSVRRRARGQEVMKTVLRSLGVGDLQVFGLALLRDNEYLF
LDLEQKLRKYFGKTWSRNSLKVPFIVFLRVKFYLENGLLILSSKVQQLYYWELRQKVLQS
QDHQQEALLFQLAASALQAEVGDLERGEGAEDEGGDEKKERVQYFLPEDYFPPWLINHRG
RNFLLQHSPVLHGELRGTPRRRAILQFIKEASSLQDAALTFYRMKQGKNELRSSILLGVA
LDGVYIYQEVEGKQRVLFAFTWSEIDRFTFQGSRFEIAAVDSKLVYYTHSAFHSKHILKH
LSDSHRFYVNSKDAACYIQQLEDMQTCQLHREAYICDMTHLRQRLRCYNLTGSASDCSNV
ETDTTWNKDGAEEEQSPLSEVESEEAFVDDPAEVTWLAEFLYGASVDGPLRLPSSTWAAV
TMEMKQVLCKRVGAASRSFDSQ
Download sequence
Identical sequences M4ATU1
ENSXMAP00000017886 ENSXMAP00000017886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]