SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017895 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017895
Domain Number 1 Region: 215-451
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-56
Family DBL homology domain (DH-domain) 0.0000271
Further Details:      
 
Domain Number 2 Region: 449-574
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-34
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 32-92
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000523
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000017895
Domain Number - Region: 593-631
Classification Level Classification E-value
Superfamily Chorismate mutase II 0.0343
Family Dimeric chorismate mutase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017895   Gene: ENSXMAG00000017818   Transcript: ENSXMAT00000017921
Sequence length 900
Comment pep:novel scaffold:Xipmac4.4.2:JH558123.1:5491:20708:-1 gene:ENSXMAG00000017818 transcript:ENSXMAT00000017921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLLESRREKDRMKESSLKIKEKERLKETREREARSSSGHLFTSLSVSATTLCSSCNKS
ITAKEALSCPGCNVTIHNRCRDSVASCAKMKQRQQKLTLVRNNSALQNVALRTKTPMMKE
RPSSAIYPSDTLRQSLLGSRRVRTGLTLAKSVSTNNIAGGTEESVGLRRILSQSTESLNF
RNRTLSMESLTDDGEWWWSPLLEELQEEGGCVQADSWSMAVDSKFLQMQHKDVIKQQDVI
YELIQTEFHHVRTLRIMEGVYRRGMQEEVLLEAGVVHTIFPCLDQLLELHTNFLSQLLSR
RKDGLQEGSANNFTVRRLGDLLLRQFSGQCAEDMKKLYSEFCSRHPKAVKLYKEVLNRDR
RLQQFIRRVCRGPLLRRHGVQECILLVTQRITKYPVLIQRILDNTKGCPDERRDLQEALV
LLKELIGSVDQEVLELDRNRRLQEVQARLDPRAQAEVKGGGAFRGGELLRRKLLHEGTLT
WKVQGSRMKDVQVLLMSDILVFLQEKDQKFTFASLDKSPVVSLTKLIVREVANQEKGMYL
ISDSAPPEMYELYASSKDDRKTWMSCIQKAAQSCPSRDEFPLIETEDKALQRRLRADIQQ
KDKEVLELLQERATLFSDLVQATAREDGEERRVEAKTSSCNRNLFRADTPHAPKAEPLLL
AAIGEVDKLAALLSDTSNQKSSVTNGNQDISNGDSGSVNGSFKLNSSSKSEAVQDRNGNQ
LQERTLNEEVRQRLVGLSTQLHALQVRSSVLKLCLALPPGGGDPAGLXMSRDAALDASGE
AVLLRRQVELLQEELSRLRLKAEEGGKKGAGSGKKKKKNKGPAGASGEPGDVATANSAEV
DRKPEAEPPAVAPLALEDPVDQLDGLEEGLEEEEDEEVMKISPRSDSPRDLQDIPEESES
Download sequence
Identical sequences M4ATV0
ENSXMAP00000017895 ENSXMAP00000017895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]