SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017990 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017990
Domain Number 1 Region: 685-896
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.08e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000302
Further Details:      
 
Domain Number 2 Region: 482-609
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-24
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 
Domain Number 3 Region: 36-110
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000174
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 4 Region: 312-348
Classification Level Classification E-value
Superfamily WW domain 0.000000534
Family WW domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017990   Gene: ENSXMAG00000017939   Transcript: ENSXMAT00000018016
Sequence length 902
Comment pep:novel scaffold:Xipmac4.4.2:JH556674.1:3847288:3905645:1 gene:ENSXMAG00000017939 transcript:ENSXMAT00000018016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGSWRRSVGPTQPVAAPVVNPSAMTVCGVPSGTVVLEAQYDYSYRGSDGRQVCIREGE
RFILLKKTNADWWQVRRIGAASKTKPLYVPATYVTEVPITPMPSPQRLVTSVSLHSNMPM
LPRVSLSPSFTGPGRNEQSQVNKPMYRSMENLNTYSSAFQRSERNTVVGENHFPTLPLSG
FTFTPNSSTSQSSHLMVPGSPAASMTQANSSNPRVVPTITRSQSSSNLPENLNENPYDEV
GGGLGSRINYKVPKKSCSQWDMVGASGRNNRLQVPTEAYMSQLSWQDSPIYAEMQPEKRL
SQQEPPIPAVSQQPLQIMDLWEQYSDPGTGRCYYVNSITKERSWKPPRRSRSQCTNKSPT
QQGSPAQAQTLPRDTSHLSLPLSKTGNGTMHKLSPDYVFGSHQRNTDSSWQTKQNIERGV
SSDTLSTSALTNTEEQCRNSGSQHDAKQQFCHAQSMILSENGKLHRDSPSNVANIIVEPP
SPESSPDSDGCTPELEKAGLLNKTKIAEGGRKLRKNWSPSWVVLVGNSLVFFKDPKSQTP
SSWKPGNSRPESSVDLRGAKLNWANDLSSKKNVFKLRTITGNEFLLQSETDSLIREWYNT
IKNVIDRLDRENPLENVLQYSLRRAGSVEMLDHSGDEDDRRNSLPRSASNLENTERKRVK
TRLKKLILKRPPLQALQEKGLIKDQVFGCRLEMLCERERTTVPRFVRLCTEAVEKRGLDT
DGIYRVSGNLAVIQKLRFLVDHERALTTDGRFMFPADLVQEEKLNLDESEWEDVHVVTGA
LKLFFRELPEPLIPYGFFTDIVETVKMTDHMDKVDRLKCLVLNMPPPNHDTLEFMCRHLR
RVLEQSDTNRMTTQNIGIVFGPTLMRPECDNGNMAVNMIYQNQAVELILSEFDHIFGTRG
LS
Download sequence
Identical sequences M4AU45
XP_014331425.1.87360 ENSXMAP00000017990 ENSXMAP00000017990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]