SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018137 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018137
Domain Number 1 Region: 720-929
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.26e-51
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 1261-1293,1385-1601
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000439
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number 3 Region: 923-1028,1094-1126
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000425
Family Pleckstrin-homology domain (PH domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018137   Gene: ENSXMAG00000018091   Transcript: ENSXMAT00000018164
Sequence length 1727
Comment pep:novel scaffold:Xipmac4.4.2:JH556904.1:426202:490631:1 gene:ENSXMAG00000018091 transcript:ENSXMAT00000018164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTTLPAVSRVSKVKIPPFVSSPGDSCCSSRYSSTETLKEEDQSVLSKTYHGNFTMYRSP
SFGHGDNFSRAPVRVRPKILPTVTFIPSVTPRERKTTGREVANKANKMSMSNPDIASETM
TLLNSLKNDVPKLKVRRPSGGDRNRAGECSSEYCRDLGLLSGTILPSGHRPSLKDLTATL
RRTKSFTYSDKLTTGARSYLSGGTTKRSSSEQQLDLDEEKTEVMPTPLEERCVQEARQVI
QDICQMCSRDDDDDDLALMSSDSILGNEGLQDRSMDELSGHDSSLTDEGIVTEPESGPTD
LSERSFLGSAGGINTSSAVSTELTSAAASGEGGFESPATPSAVRRRRKFSPSDSTTAAVG
NGESTVYRSLSDPMPQRCCSLAEKGSNNFSSVDSNLLGSLSVKGGASPEASVASTLSEYI
GSVASDLSVYSDGGSRDDCIQDYSRVIRNIVAEPGAMDRLITDDHGNGKAPKKKSFSDPS
RRSEAPPVSQTDPQTGSTHQVSELDQSGQIPPSSSEPILSEQREELWDSEANCTQPLQAK
IAASQSECSAVSDNPDDDDDSIDHDQKEKFNLDLKLSEVLSPRTTRRLAKKRPNDQEEHS
NQSKLISSLPASPLKSKSKTKPKHIRNTSEPAFIPISPPAQLQPLKEVNFQAVPAEDEVP
PLEDVSQKYNLEDIESSVSAFVPLSLGCFSHPSSEVLPFEVYKPADLSTPVRSCCIILPL
VDMRKHVMMTLLDTEQSYVESLRTLIQGYMRPLKQPDGSSIVDPLLVDEMFYQIPEILEH
HEQFLEQVAGCVSQWHDRQTVGHLLIHSFSKDALADMYSAYIDNFLNAKDAVRIAKEAKP
AFHKFLEQNMRENKEKQALGDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHQFLLDAQKN
IKRLAEKINKGRRSAEEAEREARVIQEIEAHIEGVEHILNPQRKFLRQEIVMEAKTVGGK
KDRSLFLFSDLIICTTLKRKSGSLRRSSMSLYSAASVIDTSSKYKFLWKLPLEDVEVVKS
SSQATNKESIQKMITRLDEDLSTLGQISKLSETLSFPHQSLDEVIKDLMASVHKELSEKQ
SLAFSMTFLPTKLEFTTASAESTFVFEFSSPDARSSFEQAFEDAKKKLAMNKDQWDPEFL
KAIPIMKTRSGMQFSCASPSHSCPDSGCEVWVCNSDGYVGQVCLLNIKDEPTVEACIAVC
SARIICIAAVPGLKGRWEHRDRVSEPVSTSGPPTHPQQQLDISISPTTLELTEQPTVCLN
YVCVGSGNTTVGLSSPGPGAELVPFDSDDSDDEDSPSPSSTLQSQASHSTISSSYGNDEG
LSSKDMATETTSSEEEQEFPVRTSYGAPGMLGVGGGSRAHTESPMDGRAMRRSSRGSFTR
ASLEDLLSIDPEAYQSSVWLGTEDGCIHVYQSSDNIRNRKNSMKMQHSASILCILYFDNK
VFVSLANGEVIVYQREAGSFWDPQSSQMLVLGTPSSPVTKMVPVGRKLWCGSQNRVLIIN
TTTLVQEHWFQVGTDSNRCVTCMVAYGQGVWLALQGSAQVRLYHTETWESLTEVDVAPAV
HKMLAGADAIIRQHKAACLRITALLACKDLLWIGTSAGVVLTLAIPTVSTGTGAGTLKSP
LVPIGSAHGHTGHVRFLTSIELPEGFDMNFPPTTTDSTGNQPPSSSVDDESLQRRDSAHR
RTSTHIPVKTNHLVISGGDGYEDFRLTNSSETIGRDDSTNHLLLWRV
Download sequence
Identical sequences M4AUJ2
ENSXMAP00000018137 ENSXMAP00000018137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]