SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018281 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018281
Domain Number 1 Region: 7-148
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-38
Family Phosphotyrosine-binding domain (PTB) 0.000000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018281   Gene: ENSXMAG00000018225   Transcript: ENSXMAT00000018308
Sequence length 557
Comment pep:novel scaffold:Xipmac4.4.2:JH557008.1:69407:92003:-1 gene:ENSXMAG00000018225 transcript:ENSXMAT00000018308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQDRTEAGLIKRFRGDGVRYKAKLIGIDEVTAARGDKLCQDSMMKLKGMASSARSKGEHK
QRVFLTVSFGGIKIYCERSGVLLHHHSVHEISYIAKDTRDHRAFGYVCGKEGHHRFVAVK
TAQSAEPLILDLRDLFTLIYDIKQREEMEKKAQKDKHCEQAVYQTILEDEVDDPVYQYIV
FEAGHEPLRGPQSEESVYQVPTSQQKEGIYDVPKRHFMTNGMKFDRSPVSFAAAWMRGSL
PLFPNFFVIVENINHFDLFGDMSTPPSMPPSPANTLDPNRSSRQQQQHTPAELYAPFSPT
SMPSGYMTMGPVQAAQWAQQPFPSQAQTLTFPVQGPLQVAQVLPGGQPIILSQANIFPTT
QQQWAAMAAYMPAQTVGVGGHAIPAAMLQGLVPITTVCPQTCDLSAPSSAITSPHHMADP
ALLQRQLSLGCGTPGLMSAPDTLVCSQLLPPQAAANQEEEGSCSDLDLSRMTLSPGTSTS
PSTESPSTPAPQQSSSSDCPPSQGSDPPTDHSPVDPEGPPSNTREEQSPTQGWASSDSLV
PSEGGEPTDQTGPQKDS
Download sequence
Identical sequences M4AUY6
ENSXMAP00000018281 ENSXMAP00000018281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]