SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018509 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018509
Domain Number 1 Region: 689-962
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-72
Family Protein kinases, catalytic subunit 0.00000621
Further Details:      
 
Domain Number 2 Region: 1694-1981
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-60
Family Protein kinases, catalytic subunit 0.000041
Further Details:      
 
Domain Number 3 Region: 190-308
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-28
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 
Domain Number 4 Region: 2-178
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-25
Family DBL homology domain (DH-domain) 0.00058
Further Details:      
 
Domain Number 5 Region: 314-413
Classification Level Classification E-value
Superfamily Immunoglobulin 5.3e-23
Family I set domains 0.0067
Further Details:      
 
Domain Number 6 Region: 585-677
Classification Level Classification E-value
Superfamily Immunoglobulin 2.91e-22
Family I set domains 0.005
Further Details:      
 
Domain Number 7 Region: 403-497
Classification Level Classification E-value
Superfamily Immunoglobulin 3.16e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 8 Region: 1587-1672
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000769
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018509   Gene: ENSXMAG00000018460   Transcript: ENSXMAT00000018537
Sequence length 2011
Comment pep:novel scaffold:Xipmac4.4.2:JH556710.1:1355155:1370704:1 gene:ENSXMAG00000018460 transcript:ENSXMAT00000018537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLIQGLIDGEEEFVKAMKMFITHQLNHLDCSHHIPINILNQKEIIFRNIKDIVGLHERSI
LPGLRECVTDDDVAMYLIKHPEHFEKYLHYMVGQAQAEACISDKTVQQYFKDITAPEKPG
DAPIMDVLTFLQQPVERIQTYQALLKELIKNKAKSGQSCYLLEDAFSVVSCLPWRSDNLH
RVSLIENYPAPLTALGEPVRQGVFTVWEESPEVKTSSRGHQRQVFLFKECIVLCRVKRDG
SMNRDTYSFKNKMKLNDVEIKETVGGEDRSWGLWHEHRGSIRRYTLQSNSTLVKLSWLKD
LKELQHRSSLSNNCPPVFESLLCDCSTQIGQTIKLTCRVLGFPKPVVSWIKDGLPLEDDP
RHIVSADRSGTCSLVLDCLTAEDSGQYMCYATSSMGSAGTLAKVVVQAPPRFVSRLESAC
LIDGEEIQFSCSTLTTPLPRIRWLKDGKELTDSNKYSIVNDARSGILSLTVIRATEADIG
QYECELWNELGCVKCKAGLCPAFVPPGDSESDQSQDLPVKADSEAWSTAFVKKWLQTDFS
PSSIAKYSTVVDVHPSAVQKSSCYLEEEEEIYISEALHEITDAPPSVQVPAEDLCVEPGQ
PATFMAIITGRPTPKVQWYKHDKEPLEPNENVKIVQHGARCSLTILCPEGEDSGTYTCFT
HNDSGQASCEAQLTVEEGLLDPQEREVELGKRRRLFSVYDVHEEIGRGTFGVVKRVIHRR
TGEVFSAKFLPLRSSSRTRAFQERDLLSRLAHPRVACLLDFFCTRRTLVLITEICCSHGL
LDHLLMRGSVSEKEVQFYVQQILEGVCHIHSMNIMHLDIKPENILMVYPPKDEIKICDFG
FCQEIDTSRHQYSMLGTPEFVAPEIVHQEPVTVATDIWAVGVITFLCLVCRCPFVGETDR
ATLLRVGEATLNWDAPDIECRSPEARNFLHTVLQPDPETRPSAFECLSHEWLQDGNAGED
TDEINTRSLKVFISKRKWQRSLTSIGSVLTLRPIPELLDAPLRETSVAVPREPQEHSSTS
LSSGSSSEYDEADSWDFFQHCSQTEEEEEETEEEYDPLTERAQILEPDEDGEMGGRRSVI
ERSMSRASIASSSTTTDQQTPQRDSNPSLYLSDGDEGSGSDGGRIPRGSVIRSTFYNSSQ
QLSPLSARHMTLRDKFQAKKQERGRKPLRRSFSGRLNEPLIEYVEDEPESNRGQRRGSVQ
PSMQKSSSFDDGVGLSHTNVPPHRRSRSLDEYSRRSPSSASHESAHEEEASHSMKEEITD
GEAAGRNSLIIQKASKVSGRRGSVALTQGLFRGSSVPSEFLAGGRMRSRLGQDQVEGDTL
TSSQGSLAESFILEHGGSESSSRIGSFDELSHGHVGRRFRSGESDENDEHSEPLITPSPT
PFQEIKPRSSRPQPPPRNRTRSNPNLSTISKGQPERPSMPSPSPSLCSLGTPERPSRARD
KKEGSMLQRHASAPALEARPPTGTSPKLGLLRIFRRQSWTGHSYTQLENTELGPTLGEIM
KPDTPTMSLRKKMRASASSLTKLFSRSSSKEDVSKGRKGPIVKGSAAIPGEREQSSGLET
PKKRSSKLLSSFKIPPFKKIKVMSVRPSKAEVLQLDGGGVLLVWRPVQSDDPVTYCVQYC
SDGGEWTVLSDEVAESCYVVKDLPKGASYVFRVGCVTRTGAGPFSEASAPIVMSTHPEDI
RIPLIQTDSIGSKVPGSEHQTVNRNYSFLSEINRGRFSVINLCRDVETSQVFAAKITPYQ
AAQRQLVLREYQLLRRLHHPHLVQLYAAFITPLYVLLVEELCPGKELLHSLAASLRDLYA
ESNVAELLHQIVSAADYLHSRRVIHLDLKSDNMLVDDGNHLKIIDFGSAQSFVPGQPLNI
EHIHGFSDSKVYIVLPKAPEILEGQGVGPETDIWAIGVLSFIMLSADSPFYAEHSWEQDK
NIKKGKIQFGRCYPGLSEGALNFMKNSLNNKSWGRPTSAECLQNPWLRAHRAPHKVRPSK
VCFSTDKLRAYLKQKEEKRDQVCTKHQGPFF
Download sequence
Identical sequences M4AVL4
ENSXMAP00000018509 ENSXMAP00000018509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]