SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018623 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018623
Domain Number 1 Region: 1451-1629
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-44
Family DBL homology domain (DH-domain) 0.0000568
Further Details:      
 
Domain Number 2 Region: 1639-1754
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-36
Family Pleckstrin-homology domain (PH domain) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018623   Gene: ENSXMAG00000018570   Transcript: ENSXMAT00000018651
Sequence length 1946
Comment pep:novel scaffold:Xipmac4.4.2:JH556682.1:2585091:2621288:1 gene:ENSXMAG00000018570 transcript:ENSXMAT00000018651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPESLDLSIQSALSALFPPFEVTAPIVLCQLFRTIDERYHGDALQCLLDFLIPSKHLLE
SVQQAACAGYSDVVFRCEGWPLCLHDKTVVQLASVNPLLLRPGDFYLQVEPFGDQAARIV
LKSLLEEGCREVEETPIPETSYPCLFTEEWLQDINEGRHGTPLSRCLLCTDQGVIKLQWS
EISIPEFLDKPKTVSACGEAAPQTKKASASSHFNSSTLPVEAVKLPQEDRMSASLRPLHT
SSKLIKMERRPPRSGSKPMNKPVGWVSPNTWESLTYQEIEGDYVDLVEFAKGKEFVDKQI
QPISVLPKPVRQPPPIPLGNSGQTLQYADEPCMPCGQRQLDQDLIDLDLKCRYRDSYVAA
LKNPVPFERGGVDLLGALEEVGLFEDDDVRPGGAFEGQKDHLCNLSNHCKEPAMDSESCE
STGCHRPLSCESENTMKESALILKPFSGLSPSDSKLTSHQLGHAFFKHPGLGLKTRQKED
GVKPSGKHKVKVRSMSALSDTPTGSPILYKINNRSHSDVCPETVTSIMQHQNSTAEYQEA
SNVERLKQKKKKKKKTSARNSTVTLLCLRECGSSEGYTLQNKGSKVKDQTSAQSSSRESP
LCCLRSLAGRSHSREGKEIATCTPVKEGLNPVGGLRMPSEGREPQKPKSLHTIYLDSSTS
SMNGLGSKLFSIKVEKQPSATGSGCQQGSQTEQSCLRKIRGLLELGIICLPGSRDRNGRA
VVEVHGDRKEWMSPLVSAESICELLLYLHSIPRKDVRELGMTLVINGKKKPPPLHLYKAL
LMAQEQALHAVHSIIMLIDKDSSPRPEKQPGLQMDVVTSMRALSKTVEAPQLTSDLGGTF
AYNHKDWMQFHQKHVPFMANLRGANSLLQKAIKRVDRRKPMDSAEEVQESIQEQRVLMKE
VLEDDRLVTLQKEGGTLLARMKKEEFRFLQSEDYRDALELATSLYNQVEEKLHMLVMKSN
ESLQHLENLLRHRDIQISLHLVASIYSVEGKTSSEDDAGITGYQIRERLKKSTLLCNLSQ
DKQQYALILIKEAEEIIGTINSSPAAEIFRTLVGTFKSNVEDFVLRAEQRQKDLLSVVHL
YRFCKQATDWAKECRSLLEQIEAGCCSSQTLNTLQMQKERLTGEFSAPHFQALRAKASAM
GAESSGMLRAWNAAWVQSQEVKQRLEEMQEKHKGVEKNPTQHTTAANPLGEHEEKEREGK
RNEPGEARNVQIPQQSSHVEVVSTAKCQGETISAAFSKHNCESDLSIKKELLEAQCNNSK
NTSDLSQTGDFHTASQCKSKEHHSITDLSTVGPAERKDFPVHQTLGRSLSEGSHKHCHSR
KHSLDQNLQPTQKLQTFRQKATFFSKGYWRIVSGKQQMQSHTLEIKCCHLISKLLKLIKD
LESLETEMNKILTIYGYFNASGVTSKCNGYCNIASTDNISSTKCSEKVLKSLSLEKVKKN
EKKNDNTTKTKKVLKILEELLSTEREYVKALGYVREHYFPELERADVPQDLRGQRGSIFG
NLEKLHDFHHHYFSDELESCVKEPFRVGRCFLRHRESFALYALYSKNKPQSDSLLTNHGK
SFFKQKQLKLGDKMDLWSYLLKPVQRISKYSLLLQDVMRECGPEQTKEVAEIKAALEVIH
FQLRHGNNLLAMDAIRQCDVNLKEQGQLIRQDEFLVTFRKKKCLRHIFLFQDLVLFSKTR
KTDVGNDTYVYKQSFKTSDIGMTQNSGDSGLCFEIWFRKRKSQDTYTLQAESREVKEAWT
KDLERILWEQAIHNREVRMQERVFLGIGNKPFMDIQPSEAAISDRAINYVLIGRENKVLS
SLGSCGSQGGLLEGRPKSVGSGSSSSSSSSSGRGSMPPIGFVGGPKRRVVSGGLVGYVSP
PGSLEEDELDRESGNQNLLLDSSESSGESVSGFSSCSHSCRSAAGESAVSSPSPAAPRMK
LKQQHQTEDLPDSKGESTSAGKSTEV
Download sequence
Identical sequences M4AVX8
ENSXMAP00000018623 ENSXMAP00000018623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]