SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018668 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018668
Domain Number 1 Region: 355-735
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.44e-116
Family Oxysterol-binding protein 0.0000506
Further Details:      
 
Domain Number 2 Region: 119-240
Classification Level Classification E-value
Superfamily PH domain-like 9.65e-24
Family Pleckstrin-homology domain (PH domain) 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018668   Gene: ENSXMAG00000018609   Transcript: ENSXMAT00000018696
Sequence length 861
Comment pep:novel scaffold:Xipmac4.4.2:JH556751.1:79706:123776:1 gene:ENSXMAG00000018609 transcript:ENSXMAT00000018696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEENLLQRRLSLCPSATSPPKIDPRTLTRNLSYGGDNDIYNFSPGSETDRNALSMLSSE
LSPAQSPDSKSESRMFNGVEKDSPSPTEKLARKESLKVQKQNYRQEKKRAAKELSTALKD
PSVVVMSNWLKIRGSLKSWTKLWCALRPGVLLIYKTPTPDHWVGTILLSACKLIERPSKK
DGFCFKLYHPLEKSIWAIKGPKGENVGSITQPLPSNYLIFRATSESDGRCWMDALELALS
SSSLYKMSPRPEKEGDICMASDSSHILQLLQSSPLTATELQQLSHMEHDGSSDKSERETH
DDWDTTGNENGGRLTEESDIEPLEEMPPGPQATAYVEQSTEEMAEAGEATQVETVSEENK
GLIWGLLKQLRPGMDLSKVVLPTFILEPRSFLDKLSDYYYHADLLSEASLEESAYGRIKQ
VLRWYLSGFYKKPKGLKKPYNPILGETFRCCWLHPQTDSCTFYIAEQVSHHPPISAFYIC
NRKDGFCIGGSILAKSKFYGNSLSAILDGKARLLFLSRDEEYAITMPYAHCKGFLYGTMT
LELGGKVTIECEKTKCFAELEFKLKPFLGGASSVNQISGKIVMGDELLATIDGHWDSEVF
IQEKRSSLQETLWNPVKEIRSRRLKRQVVQLDQQGEFESERLWQHVTSAILDRDQVRATQ
EKFVLEEAQRKEAKERGERLWIPKLFQQDPVTSEWTYKHLDTRPWDAEACLVQFEKDGVI
QTQEKMQRQHNGLSYNHSWSRQHKAEVNGKHRKASSQPSTCSQNTESSSTTPEPTHESSD
NEGFSSQCARCSKEVKDIALIEASITSIQRTQQDIQRNLAALGRQLSLQRHTDDSMSLTG
RHCLILCVLLLSQLLLNYVFT
Download sequence
Identical sequences M4AW23
ENSXMAP00000018668 ENSXMAP00000018668 XP_005803287.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]