SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018683 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018683
Domain Number 1 Region: 80-316
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-56
Family DBL homology domain (DH-domain) 0.0000302
Further Details:      
 
Domain Number 2 Region: 314-445
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-33
Family Pleckstrin-homology domain (PH domain) 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018683   Gene: ENSXMAG00000018641   Transcript: ENSXMAT00000018711
Sequence length 931
Comment pep:novel scaffold:Xipmac4.4.2:JH556710.1:1693593:1710634:-1 gene:ENSXMAG00000018641 transcript:ENSXMAT00000018711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPITCVSSLFPSAERPGQGERSGRSLPGDMDEIDSLRSKRCNDDAVSLAPSIAESIIVED
AHYAAVRADLESDAQDLEADSWSLAVDQYYLKKHSKDVVKRQDVIYELMQTEMHHVRTLK
IMLRVYVREMKENLQMDSGRLDCLFPRLENLLDLHTHFLSCLRERRRENLVSPSDRNYTI
NRVADILIAQFSGEIGERMKNCYGDFCSHHTEAVSLYKEMLQNNRRFQNLIRKISNLSIV
RRLGVTECILLVTQRITKYPVLVERILHNTEANTEEHQDLTRALSLIKDTIKEVDTLVNL
HEKESRLRDIHSKMEPKTQGKIKDDRVFRREDLAQGRRWLLHEGTVSWKAASGRLKVSDI
LAVLLSDVLLLLQEKDQRYVFATVDNKPSVISLQKLIVREVAHEEKAMFLICASSNEPEM
YEIHTASKEERNSWMTYIRQAVESCPHSEERLFSEEEEARAARLREFQERLSQRDAVIAQ
ALTEKLQLFAEMAGSVAGLEDTASRSKLLLRSDASDLQQGEVLLKGAITDVENLQNLLQA
GVKEEAQATQTEDGSVSGVLPRRAGTFGGYDSSPVILSKNGSAKKSFSGESRNRDRSQRA
SSDPQLKGLRGSHTLEQTVGAKQVHTQGVVLPSIIQQEFFDKVLMLSQRLYSLQAIVSQQ
DSQIELQKASLTERVSLPGRNKGNGLLEQEKQRTLALQREELAYLNKLQSQHRQEQQRWE
KERERHRQQVEATEARLQQREEECRKLEEQLAKEKEELDRQRETYQKDLERLRESTRAVE
KEKERLESQRKMKRKTIEPCCIMAVVFFQFRSVAHPLNCLNGDLISSSGLSSSTCVAELP
HSQKPLVRGSLSVAQADYPERPEIMLRRDTSSSTLPLPQKTEVPLHLFSTTNQQHKPVGV
QQQIPTKLAAINSGKGKGSKSGKASHRTDSS
Download sequence
Identical sequences M4AW38
ENSXMAP00000018683 ENSXMAP00000018683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]